DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Prosbeta7

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster


Alignment Length:242 Identity:47/242 - (19%)
Similarity:89/242 - (36%) Gaps:44/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ERYSFS------------LTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPL 56
            |.|:|:            |||..|.|    .:::.|:.:.|...:||...:||::|.:.     |
  Fly    21 EFYNFTGGQTPVQQLPRELTTMGPYG----TKHSTASSTTGTSVLGIRYDSGVMLAADT-----L 76

  Fly    57 YEQHSVHR---VEMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTY-------KEPIPVSQLV 111
            ....|:.|   :|.::.....:..|...|:..:....|.|.|......       .:|..::..:
  Fly    77 VSYGSMARYQNIERVFKVNKNILLGGSGDFADIQSIKRNIDQKMIEDQCCDDNIEMKPKSLASWM 141

  Fly   112 QRVATLMQEYTQSGGVRPFGVSLLICGWDND-RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLE 175
            .||.     |.:...:.|..:.:::.|.||: .|||...|..|..:.....|.|.........:.
  Fly   142 TRVL-----YNRRSRMNPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATGFARHLAVPLVR 201

  Fly   176 KRYSED-----LELDDAVHTAILTLKEGFEGKMTADNIEIGICDQNG 217
            ::..:|     :|..:.:.|.:..|.  :..........:|:|..||
  Fly   202 EKKPKDRDFTAVEASELIRTCMEVLY--YRDTRNISQYTVGVCSVNG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 46/240 (19%)
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 37/199 (19%)
PRE1 60..232 CDD:223711 33/183 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.