DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and psma2b

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001122146.1 Gene:psma2b / 403015 ZFINID:ZDB-GENE-060503-941 Length:234 Species:Danio rerio


Alignment Length:233 Identity:184/233 - (78%)
Similarity:209/233 - (89%) Gaps:0/233 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRV 65
            ||...||||||||||||||||:|||||||:.|||||||.||||||:|||.|.||.||::.|||:|
Zfish     1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKASNGVVLATEKKQKSILYDEQSVHKV 65

  Fly    66 EMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPF 130
            |.|..||||||||||||||:||::|||:||.|:|.|:||||..|||||||::|||||||||||||
Zfish    66 EPITKHIGMVYSGMGPDYRVLVRRARKLAQQYFLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPF 130

  Fly   131 GVSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTL 195
            ||||||.|||.|||||:|||||||||||||||||||.|||||||||||:|||||:||:|||||||
Zfish   131 GVSLLIAGWDEDRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTL 195

  Fly   196 KEGFEGKMTADNIEIGICDQNGFQRLDPASIKDYLASI 233
            ||.|||:||.||||:|||::.||:||.||.:|||||:|
Zfish   196 KESFEGQMTEDNIEVGICNEAGFRRLSPAEVKDYLAAI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 179/224 (80%)
psma2bNP_001122146.1 proteasome_alpha_type_2 6..231 CDD:239719 179/224 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578408
Domainoid 1 1.000 305 1.000 Domainoid score I1343
eggNOG 1 0.900 - - E1_KOG0181
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2081
Inparanoid 1 1.050 381 1.000 Inparanoid score I2021
OMA 1 1.010 - - QHG54016
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0003690
OrthoInspector 1 1.000 - - otm26345
orthoMCL 1 0.900 - - OOG6_101969
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.