DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Prosbeta6

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster


Alignment Length:207 Identity:51/207 - (24%)
Similarity:79/207 - (38%) Gaps:24/207 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYNHIGMVYSGMG--PDYRLLVKQARK 92
            |.|...|.|...:..|||.:.:..|. |..||..:.::.......|....|  .|...|....:.
  Fly    27 SNGGSIVAIAGDDFAVIAADTRLSSG-YNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKV 90

  Fly    93 IAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDND-RPYLYQSDPSGAYF 156
            ..|:|..|:...:....:.|.::..|  |.:.  ..|:.||.::.|.||: :..:|..||.|  .
  Fly    91 RMQSYEHTHLRTMTTEAVAQMLSIAM--YNRR--FFPYYVSNILAGIDNEGKGVVYSYDPIG--H 149

  Fly   157 AWKAT--AMG----------KNAVNGKTF-LEKRYSEDLELDDAVHTAILTLKEGFEGKM-TADN 207
            ..|||  |.|          .|.:..|.. ||......|..:.||..|..|.....|..: |.|:
  Fly   150 CEKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDS 214

  Fly   208 IEIGICDQNGFQ 219
            :.|.|..::|.:
  Fly   215 VLINIITKDGIE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 51/207 (25%)
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 51/207 (25%)
PRE1 24..225 CDD:223711 50/204 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441069
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.