DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Prosbeta2

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster


Alignment Length:239 Identity:45/239 - (18%)
Similarity:92/239 - (38%) Gaps:54/239 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GAPSVGIIASNGVVIATENK-HKSPLYEQHSVHRVEMIYNHIGMVYSGMGPDYRLLVKQARKIAQ 95
            |...||||..:||::..:.: .:.|:....:..::..:..:|....:|...|..:.........:
  Fly    39 GTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQLE 103

  Fly    96 TYYL-TYKEPIPVSQLVQRVA--TLMQE--YTQSGGVRPFGVSLLICGWDNDRPYLYQSDPSGAY 155
            .:.| |.:|       |:.||  |::::  :...|.:   ..:|::.|.|...|::|...|.|:.
  Fly   104 LHRLQTDRE-------VRVVAANTMLKQMLFRYQGHI---SAALVLGGVDKTGPHIYSIHPHGSS 158

  Fly   156 FAWKATAMGKNAVNGKTFLEKRYSEDLE-------LDDAVHTAILTLKEGFEGKMTADNIEI--- 210
            .......||..::...|..|.|:..||.       :.||:.:.:      |....:..||::   
  Fly   159 DKLPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASGV------FNDLGSGSNIDLCVI 217

  Fly   211 -----------GICDQNGFQRLD-----------PASIKDYLAS 232
                       .:.::.|.::||           ..:|||.|.:
  Fly   218 RKGSVEYLRNYELANKKGKRQLDYRFKTGTSTVLHTNIKDLLVT 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 44/236 (19%)
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 37/205 (18%)
proteasome_beta_type_7 42..228 CDD:239732 37/201 (18%)
Pr_beta_C 232..264 CDD:289249 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.