DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Prosbeta5R1

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_611776.1 Gene:Prosbeta5R1 / 37690 FlyBaseID:FBgn0034842 Length:315 Species:Drosophila melanogaster


Alignment Length:180 Identity:40/180 - (22%)
Similarity:73/180 - (40%) Gaps:18/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GAPSVGIIASNGVVIATENKHKSPLYEQHSVHR--VEMIYNHIGMVYSGMGPDY---RLLVKQAR 91
            |..::|.....||::..:::..|..|......|  ||:....:|.:..|.....   |:|.|:.|
  Fly    71 GTTTLGFKYRGGVILCADSRATSGQYIGSQTMRKIVELNDYMLGTLAGGAADCVYWDRVLAKECR 135

  Fly    92 KIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDNDRPYLYQSDPSGAYF 156
                .:.|.|::.:.|....:.:..:..||...|.|    :.:::.|:|::.|.|...|..|...
  Fly   136 ----LHQLRYRKRMTVDTAARIICNISTEYKGMGLV----MGMMLAGFDDEGPKLIYVDSEGMRS 192

  Fly   157 AWKATAMGKNAVNGKTFLEKRYSEDL---ELDDAVHTAI--LTLKEGFEG 201
            ..:..::|..:......|:..|..||   |..|....||  .|.|:.:.|
  Fly   193 HGQVFSVGSGSPYALGVLDTGYRYDLSDQEAYDLARRAIYHATSKDAYSG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 40/180 (22%)
Prosbeta5R1NP_611776.1 PTZ00488 39..272 CDD:185666 40/180 (22%)
proteasome_beta_type_5 72..259 CDD:239730 39/179 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440923
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.