DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Prosalpha7

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster


Alignment Length:227 Identity:74/227 - (32%)
Similarity:116/227 - (51%) Gaps:5/227 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYN 70
            |..|.:.|||.|::.|::||..||......:||...:.||:|.|....|.|||..:..|:..|..
  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEK 72

  Fly    71 HIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLL 135
            :|||..:|:..|...:...||:.|..|...:::.||:..|..|||..:..||....|||||:|::
  Fly    73 NIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSII 137

  Fly   136 ICGWDN-DRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTA-ILTLKEG 198
            :..||. :.|.||:.:|||:.|.:.|.|.||.....||.:|| ...|:..|:.|.:| .:..|..
  Fly   138 LASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEK-LKMDMRTDELVESAGEIIYKVH 201

  Fly   199 FEGKMTADNIEIGICDQ--NGFQRLDPASIKD 228
            .|.|......|:|:..:  .|...::|:.:.:
  Fly   202 DELKDKDFRFEMGLVGRVTGGLHLINPSELTE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 74/227 (33%)
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 72/208 (35%)
PRE1 6..231 CDD:223711 74/223 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440999
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.