DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Prosbeta4

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster


Alignment Length:209 Identity:36/209 - (17%)
Similarity:86/209 - (41%) Gaps:37/209 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VGIIASNGVVIATENKHKSPLY----EQHSVHRV--EMIYNHIGMVYSGMGPDYRLLVKQ---AR 91
            :||...:.|::|.:..|...:.    :|:.:|:|  .::.:.:|  .||....:...:.:   ..
  Fly     5 LGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVG--ESGDTEQFTEFISKNIALY 67

  Fly    92 KIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDNDRPYLYQSDPSGAYF 156
            |:...|.|:.:|....::      ..:.||.:|.  .|:.|.:.:.|:|.:      :.|...:.
  Fly    68 KMRNGYDLSPRESAHFTR------KNLAEYLRSR--TPYQVFMFVAGYDPN------AGPELTFI 118

  Fly   157 AWKATAM-------GKNAVNGKTFLEKRYSEDL---ELDDAVHTAILTLKEGFEGKMTADNIEIG 211
            .:.|.|:       |..|:...:..::.:..::   |..|.....|..:::..  .:...|..:.
  Fly   119 DYLANALPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRL--VVNLKNFTVA 181

  Fly   212 ICDQNGFQRLDPAS 225
            :.|::|.:.|:|.|
  Fly   182 VVDKDGVRDLEPIS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 36/209 (17%)
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 34/206 (17%)
proteasome_beta_type_2 1..192 CDD:239727 33/204 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.