DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Prosbeta4R1

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster


Alignment Length:212 Identity:49/212 - (23%)
Similarity:93/212 - (43%) Gaps:27/212 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VGIIASNGVVIATEN-KHKSPLYEQHSVHRVEMIYNHIGMVYSGMG------PDYRLLVKQARKI 93
            :|:..::.:::|::. ::||.::....|.:...|.::..|..:|.|      .|:.|......||
  Fly     5 LGVKGTDFIILASDTMRNKSAMWLDDEVRKTHRISDYCMMSTAGDGGDCLKFSDFILRNMDLYKI 69

  Fly    94 AQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWD-NDRPYLYQSDPSGAYFA 157
            ...|.||      |...|..:...:..|.:|...  |.||||:.|:| ...|.|:..|..|....
  Fly    70 TNGYDLT------VRGAVHFIRRHLSAYLKSDCT--FQVSLLVGGYDLTSGPELHYIDYLGNSVP 126

  Fly   158 WKATAMGKNAVNGKT-FLEKRYSEDLELD---DAVHTAILTLKEGFEGKMTADNIEIGICDQNGF 218
            .:....|. |:|..| .||:.|..|::..   |.:...::.|.:.|  .:...||::.:..:||.
  Fly   127 VRYGGHGA-AMNFCTPILEEFYKPDMDTQAAYDVIKKCVIELYKRF--VINLRNIDLFLISKNGI 188

  Fly   219 QRLDPASIK----DYLA 231
            .:::..:::    |.||
  Fly   189 TKMNSINLESLRGDILA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 47/210 (22%)
Prosbeta4R1NP_608698.2 PRE1 1..204 CDD:223711 47/209 (22%)
proteasome_beta_type_2 1..193 CDD:239727 46/198 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.