DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Psma5

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_058978.2 Gene:Psma5 / 29672 RGDID:61848 Length:241 Species:Rattus norvegicus


Alignment Length:215 Identity:75/215 - (34%)
Similarity:120/215 - (55%) Gaps:5/215 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRV 65
            :....|...:.||||.|:|.|:|||:.|:..|:.::||..|.||.:|.|.:..|||.|..|:.::
  Rat     3 LTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKI 67

  Fly    66 EMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLM----QEYTQSGG 126
            ..|..|||...||:..|.:.|:.:||...|.::.||.|.:.|..:.|.|:.|.    :|....|.
  Rat    68 VEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGA 132

  Fly   127 V-RPFGVSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHT 190
            : |||||:||..|.|...|.|:..||||.:....|.|:|..:...::.|::.|.:.:.|.:|:.:
  Rat   133 MSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKS 197

  Fly   191 AILTLKEGFEGKMTADNIEI 210
            :::.||:..|.|:.|.|||:
  Rat   198 SLIILKQVMEEKLNATNIEL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 75/210 (36%)
Psma5NP_058978.2 proteasome_alpha_type_5 8..220 CDD:239722 75/210 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.