DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Psma2

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_058975.1 Gene:Psma2 / 29669 RGDID:61842 Length:234 Species:Rattus norvegicus


Alignment Length:233 Identity:181/233 - (77%)
Similarity:209/233 - (89%) Gaps:0/233 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRV 65
            ||...||||||||||||||||:|||||||:||||||||.|:||||:|||.|.||.||::.|||:|
  Rat     1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKV 65

  Fly    66 EMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPF 130
            |.|..|||:||||||||||:||.:|||:||.|||.|:||||.:|||||||::|||||||||||||
  Rat    66 EPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPF 130

  Fly   131 GVSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTL 195
            |||||||||:..||||:|||||||||||||||||||.|||||||||||:|||||:||:|||||||
  Rat   131 GVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTL 195

  Fly   196 KEGFEGKMTADNIEIGICDQNGFQRLDPASIKDYLASI 233
            ||.|||:||.||||:|||::.||:||.|..::||||:|
  Rat   196 KESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 176/224 (79%)
Psma2NP_058975.1 proteasome_alpha_type_2 6..231 CDD:239719 176/224 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338805
Domainoid 1 1.000 304 1.000 Domainoid score I1338
eggNOG 1 0.900 - - E1_KOG0181
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2081
Inparanoid 1 1.050 377 1.000 Inparanoid score I2013
OMA 1 1.010 - - QHG54016
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0003690
OrthoInspector 1 1.000 - - oto95757
orthoMCL 1 0.900 - - OOG6_101969
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2555
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.