DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and pas-4

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_492360.1 Gene:pas-4 / 172679 WormBaseID:WBGene00003925 Length:253 Species:Caenorhabditis elegans


Alignment Length:216 Identity:79/216 - (36%)
Similarity:130/216 - (60%) Gaps:15/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIY 69
            ||..::|.|||.|.|.|:|||..||..|:.:||:...:.:||..|.|....|.:..::.::.||.
 Worm     3 RYDRAITIFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDCIVIGVEKKSIPALQDDRTIRKIHMID 67

  Fly    70 NHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSL 134
            :|:.:.::|:..|.|:||.:||...|:|.||.::|:.|:.:.:.:|...|.:|||.|.||||:|:
 Worm    68 DHVMLAFAGLSADARVLVDRARIECQSYKLTLEDPVTVAYISRYIANTKQRFTQSPGRRPFGISM 132

  Fly   135 LICGWDND-RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKE- 197
            ||.|:|:| .|.|::::|||||:.:.|.|.|:.....:.:||::|||:..:|:|. |..|.:|. 
 Worm   133 LIGGFDHDGTPRLFKTEPSGAYYEYVANATGRGEKPVREYLEEQYSEENTVDEAT-TLKLVVKSL 196

  Fly   198 ------GFEGKMTADNIEIGI 212
                  |      :.||||.:
 Worm   197 AQVVPPG------SQNIEIAV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 78/215 (36%)
pas-4NP_492360.1 PRK03996 4..234 CDD:235192 78/215 (36%)
proteasome_alpha_type_7 4..212 CDD:239724 78/215 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.