DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and psma6a

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_705941.2 Gene:psma6a / 171585 ZFINID:ZDB-GENE-020326-1 Length:246 Species:Danio rerio


Alignment Length:230 Identity:78/230 - (33%)
Similarity:120/230 - (52%) Gaps:6/230 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTTFSPSGKLVQLEYALAAVS-GGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYNHIG 73
            :|.|||.|:|.|:|||..|:: ||..||.:...:..|:.|:.|....|.:..:|..:..|..:||
Zfish    13 ITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVITQRKVPDKLLDSSTVTHLFRITENIG 77

  Fly    74 MVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICG 138
            .|.|||..|.|..|::||..|..:...|...|||..|.:|:|.:.|.|||:..:||.|..:::.|
Zfish    78 CVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVVG 142

  Fly   139 WDND-RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLE--LDDAVHTAILTLKEGFE 200
            .|.: .|.:|:.||:|.|..:||||.|.......:||||:..:.|:  .|..|.|||..|.....
Zfish   143 VDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKIKKKLDWTFDQTVETAISCLSTVLA 207

  Fly   201 GKMTADNIEIGI--CDQNGFQRLDPASIKDYLASI 233
            .......:|||:  .::..|:.|..:.|..:|.::
Zfish   208 IDFKPSELEIGVVTTEEPKFRILSESEIDTHLMAL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 77/226 (34%)
psma6aNP_705941.2 PRK03996 6..239 CDD:235192 77/225 (34%)
proteasome_alpha_type_6 8..220 CDD:239723 74/206 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.