DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5245 and MZF1

DIOPT Version :9

Sequence 1:NP_650197.1 Gene:CG5245 / 41530 FlyBaseID:FBgn0038047 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_005259261.1 Gene:MZF1 / 7593 HGNCID:13108 Length:775 Species:Homo sapiens


Alignment Length:376 Identity:149/376 - (39%)
Similarity:201/376 - (53%) Gaps:18/376 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 RPHKCSHCSKTFTQNSSLKQHLHEHTGERPFKCTQCSTSFARKSHLQVHLRTHSEERPFECTHCE 199
            |..:|..|.|.|:|.|:|.:|...|||||||.|::|..||:|.|||..|..||:|||||.|..|.
Human   395 RGGRCDVCGKVFSQRSNLLRHQKIHTGERPFVCSECGRSFSRSSHLLRHQLTHTEERPFVCGDCG 459

  Fly   200 KAFKNNSHLQEHLRTHQEARPFKCSHCSKSFKLRSILQKHLLTHAE------------------R 246
            :.|..::.|:||.|.|...:||:|:.|.:||:.||.|.:|...|.:                  .
Human   460 QGFVRSARLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGPGAKPPAPPGAPEPPG 524

  Fly   247 SFKCTQCPKTFLQNDSLQIHLRVHAGEDPFKCPHCSETFARNSRLQLHLLEHAGKEPLKCSQCSA 311
            .|.|::|.::|.:...|..|..||.|:..|.|..|.|.|.|.|.|..|...|:|:.|..|::|..
Human   525 PFPCSECRESFARRAVLLEHQAVHTGDKSFGCVECGERFGRRSVLLQHRRVHSGERPFACAECGQ 589

  Fly   312 TFAMRSLYRVHVRLHTRERQYKCAECSKSFFKKSHLVEHQQVHTGERPFKCTHCFKDFKCRTHLR 376
            :|..||....|.|:||.||.:.||||.|:|.::..|.:|.:|||||:||.|..|.:.|..|..|.
Human   590 SFRQRSNLTQHRRIHTGERPFACAECGKAFRQRPTLTQHLRVHTGEKPFACPECGQRFSQRLKLT 654

  Fly   377 VHMLDHIGEKVPKCSYCSKEFKLSSQLLVHLQEHTGKNQFECPHCSKSYTTSSTLHMHLRTHTGE 441
            .|...|.|||...|..|...|...|:|..|.:.|||:..|.||.|.:|:...:.|..|.|.||||
Human   655 RHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQSFRQHANLTQHRRIHTGE 719

  Fly   442 LPFKCSHCSKLFARSAEHQEHLRTHTGEKPYKCSHCSTRYTQKSSLGRHLR 492
            .|:.|..|.|.|.:.....:|||||..|||:.|..|..|:.|.:.|.:|.|
Human   720 RPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQSTKLIQHQR 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5245NP_650197.1 COG5048 74..478 CDD:227381 143/360 (40%)
C2H2 Zn finger 84..104 CDD:275368
C2H2 Zn finger 112..132 CDD:275368
C2H2 Zn finger 139..159 CDD:275368 8/19 (42%)
C2H2 Zn finger 167..187 CDD:275368 9/19 (47%)
zf-H2C2_2 179..204 CDD:290200 13/24 (54%)
C2H2 Zn finger 195..215 CDD:275368 7/19 (37%)
C2H2 Zn finger 223..243 CDD:275368 8/19 (42%)
C2H2 Zn finger 250..270 CDD:275368 5/19 (26%)
C2H2 Zn finger 278..298 CDD:275368 8/19 (42%)
C2H2 Zn finger 306..326 CDD:275368 7/19 (37%)
C2H2 Zn finger 334..354 CDD:275368 8/19 (42%)
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
C2H2 Zn finger 474..492 CDD:275368 6/17 (35%)
MZF1XP_005259261.1 SCAN 81..193 CDD:128708
COG5048 399..757 CDD:227381 143/357 (40%)
C2H2 Zn finger 399..419 CDD:275368 8/19 (42%)
C2H2 Zn finger 427..447 CDD:275368 9/19 (47%)
C2H2 Zn finger 455..475 CDD:275368 7/19 (37%)
C2H2 Zn finger 483..503 CDD:275370 8/19 (42%)
C2H2 Zn finger 528..548 CDD:275368 5/19 (26%)
C2H2 Zn finger 556..576 CDD:275368 8/19 (42%)
C2H2 Zn finger 584..604 CDD:275368 7/19 (37%)
C2H2 Zn finger 612..632 CDD:275368 8/19 (42%)
C2H2 Zn finger 640..660 CDD:275368 6/19 (32%)
C2H2 Zn finger 668..688 CDD:275368 6/19 (32%)
C2H2 Zn finger 696..716 CDD:275368 7/19 (37%)
C2H2 Zn finger 724..744 CDD:275368 7/19 (37%)
C2H2 Zn finger 752..772 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.