DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5245 and ZNF571

DIOPT Version :9

Sequence 1:NP_650197.1 Gene:CG5245 / 41530 FlyBaseID:FBgn0038047 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_016882344.1 Gene:ZNF571 / 51276 HGNCID:25000 Length:651 Species:Homo sapiens


Alignment Length:478 Identity:180/478 - (37%)
Similarity:249/478 - (52%) Gaps:43/478 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PVKGVPSKLKTCKSKIAKKRPLRKQTDTF---KCTQCQK---TFTRKENLESHLRLHAEERPFEC 112
            |.|....|.|.|:...:....|.:..:..   ||::.:|   ||::|.:...|.|:...|:|:||
Human   175 PTKEKLYKCKECRQGFSYLSCLIQHEENHNIEKCSEVKKHRNTFSKKPSYIQHQRIQTGEKPYEC 239

  Fly   113 SHCSKSFGRRTHYKRHLLKHEK-----RPHKCSHCSKTFTQNSSLKQHLHEHTGERPFKCTQCST 172
            ..|.|:|||.:    .|::|:|     :|::|:.|.|.|.:.|.|.:|...||||:|::|.:|..
Human   240 MECGKAFGRTS----DLIQHQKIHTNEKPYQCNACGKAFIRGSQLTEHQRVHTGEKPYECKKCGK 300

  Fly   173 SFARKSHLQVHLRTHSEERPFECTHCEKAFKNNSHLQEHLRTHQEARPFKCSHCSKSFKLRSILQ 237
            :|:..|...:|.|.||.|:|:||..|.|||...|.|..|.|.|...:|::|..|.|:|.|.|.|.
Human   301 AFSYCSQYTLHQRIHSGEKPYECKDCGKAFILGSQLTYHQRIHSGEKPYECKECGKAFILGSHLT 365

  Fly   238 KHLLTH-AERSFKCTQCPKTFLQNDSLQIHLRVHAGEDPFKCPHCSETFARNSRLQLHLLEHAGK 301
            .|...| .|:.:.|.:|.|.||....|..|.|:|.||.|::|..|.:||.|.|:|..||..|:|:
Human   366 YHQRVHTGEKPYICKECGKAFLCASQLNEHQRIHTGEKPYECKECGKTFFRGSQLTYHLRVHSGE 430

  Fly   302 EPLKCSQCSATFAMRSLYRVHVRLHTRERQYKCAECSKSFFKKSHLVEHQQVHTGERPFKCTHCF 366
            .|.||.:|...|...|....|.|:||.|:.|||.||.|:|.....|.|||::||||:||:|..|.
Human   431 RPYKCKECGKAFISNSNLIQHQRIHTGEKPYKCKECGKAFICGKQLSEHQRIHTGEKPFECKECG 495

  Fly   367 KDF------------------KCR---------THLRVHMLDHIGEKVPKCSYCSKEFKLSSQLL 404
            |.|                  :|:         |.|..|...|.|||..||..|.|.|...|||.
Human   496 KAFIRVAYLTQHEKIHGEKHYECKECGKTFVRATQLTYHQRIHTGEKPYKCKECDKAFIYGSQLS 560

  Fly   405 VHLQEHTGKNQFECPHCSKSYTTSSTLHMHLRTHTGELPFKCSHCSKLFARSAEHQEHLRTHTGE 469
            .|.:.|.|:..:||..|.|::...|.|..||||||||.|::|..|.:.|:|.:|...|.|.||||
Human   561 EHQRIHRGEKPYECKQCGKAFIRGSHLTEHLRTHTGEKPYECKECGRAFSRGSELTLHQRIHTGE 625

  Fly   470 KPYKCSHCSTRYTQKSSLGRHLR 492
            |||.|..|...:...|.|.:|.|
Human   626 KPYTCVQCGKDFRCPSQLTQHTR 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5245NP_650197.1 COG5048 74..478 CDD:227381 170/442 (38%)
C2H2 Zn finger 84..104 CDD:275368 7/22 (32%)
C2H2 Zn finger 112..132 CDD:275368 7/19 (37%)
C2H2 Zn finger 139..159 CDD:275368 7/19 (37%)
C2H2 Zn finger 167..187 CDD:275368 6/19 (32%)
zf-H2C2_2 179..204 CDD:290200 12/24 (50%)
C2H2 Zn finger 195..215 CDD:275368 9/19 (47%)
C2H2 Zn finger 223..243 CDD:275368 8/19 (42%)
C2H2 Zn finger 250..270 CDD:275368 8/19 (42%)
C2H2 Zn finger 278..298 CDD:275368 9/19 (47%)
C2H2 Zn finger 306..326 CDD:275368 6/19 (32%)
C2H2 Zn finger 334..354 CDD:275368 9/19 (47%)
C2H2 Zn finger 362..382 CDD:275368 8/46 (17%)
C2H2 Zn finger 390..410 CDD:275368 8/19 (42%)
C2H2 Zn finger 418..438 CDD:275368 8/19 (42%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
C2H2 Zn finger 474..492 CDD:275368 5/17 (29%)
ZNF571XP_016882344.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100020
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.