DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5245 and crol

DIOPT Version :10

Sequence 1:NP_650197.1 Gene:CG5245 / 41530 FlyBaseID:FBgn0038047 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_477243.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster


Alignment Length:425 Identity:164/425 - (38%)
Similarity:232/425 - (54%) Gaps:8/425 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RKQTD-TFKCTQCQKTFTRKENLESHLRLHAEERPFECSHCSKSFGRRTHYKRHLLKHE-KRPHK 138
            |..|| .|.||.|||||.|||:|::|.|.|..|.||.|.:|:|:|.|:.|...|:.||. :.||:
  Fly   298 RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHR 362

  Fly   139 CSHCSKTFTQNSSLKQHLHEHTGERPFKCTQCSTSFARKSHLQVHLRTHSEERPFECTHCEKAFK 203
            |..|.|:||:......|...|||:.|.:|..|...:.||.||..|:|:|:.|.||.|..|.|:|.
  Fly   363 CDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFS 427

  Fly   204 NNSHLQEHLRTHQEARPFKCSHCSKSFKLRSILQKHLLTH-AERSFKCTQCPKTFLQNDSLQIHL 267
            ...|...|:..|....|.:|..|||:|..:..|..|:..| .|...:|:.|.|||.:.:.|..|:
  Fly   428 RKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHI 492

  Fly   268 RVHAGEDPFKCPHCSETFARNSRLQLHLLEHAGKEPLKCSQCSATFAMRSLYRVHVRLHTRERQY 332
            |.|.||.||||.:|::.|.|...:..|:.:|.|:.|.||:.|:.||..:.....|||.||.:..:
  Fly   493 RQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPH 557

  Fly   333 KCAECSKSFFKKSHLVEHQQVHTGERPFKCTHCFKDFKCRTHLRVHMLDHIGEKVPKCSYCSKEF 397
            :|:.|.|:|.:|.||..|.::|||:.|.||.:|.|.|..:.||..||..|..:....|:.|:|.|
  Fly   558 RCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPF 622

  Fly   398 KLSSQLLVHLQE-HTGKNQFECPHCSKSYTTSSTLHMHLRTHTG----ELPFKCSHCSKLFARSA 457
            .....|:.|:.. |||...|.|..|.||:.....|..|.|:||.    |.||.|..|.|.|....
  Fly   623 TRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKG 687

  Fly   458 EHQEHLRTHTGEKPYKCSHCSTRYTQKSSLGRHLR 492
            ....|:|:|:||||:.|:.||..:.::.:|.||::
  Fly   688 HLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMK 722

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG5245NP_650197.1 COG5048 74..478 CDD:227381 159/409 (39%)
C2H2 Zn finger 84..104 CDD:275368 13/19 (68%)
C2H2 Zn finger 112..132 CDD:275368 7/19 (37%)
C2H2 Zn finger 139..159 CDD:275368 6/19 (32%)
C2H2 Zn finger 167..187 CDD:275368 8/19 (42%)
C2H2 Zn finger 195..215 CDD:275368 6/19 (32%)
C2H2 Zn finger 223..243 CDD:275368 7/19 (37%)
C2H2 Zn finger 250..270 CDD:275368 8/19 (42%)
C2H2 Zn finger 278..298 CDD:275368 5/19 (26%)
C2H2 Zn finger 306..326 CDD:275368 7/19 (37%)
C2H2 Zn finger 334..354 CDD:275368 8/19 (42%)
C2H2 Zn finger 362..382 CDD:275368 8/19 (42%)
C2H2 Zn finger 390..410 CDD:275368 6/20 (30%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
C2H2 Zn finger 474..492 CDD:275368 6/17 (35%)
crolNP_477243.1 C2H2 Zn finger 223..243 CDD:275368
C2H2 Zn finger 251..271 CDD:275368