DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5245 and REPIN1

DIOPT Version :9

Sequence 1:NP_650197.1 Gene:CG5245 / 41530 FlyBaseID:FBgn0038047 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001374966.1 Gene:REPIN1 / 29803 HGNCID:17922 Length:626 Species:Homo sapiens


Alignment Length:606 Identity:165/606 - (27%)
Similarity:225/606 - (37%) Gaps:140/606 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NVDQRPVKDEPPQEDTFEEELIFISNSDFEELESEIKIENFC----SYGKDLEPVKGVPSKLKTC 65
            |:.:|..|...||..:.:||              |..:|..|    :.|.....:...||: ::.
Human    38 NIPKRSWKKPHPQLCSLQEE--------------EPMLERRCRGPLAMGLAQPRLLSGPSQ-ESP 87

  Fly    66 KSKIAKKRPLRKQTDTFKCTQCQKTFTRKENLESHLRLHAEERPFECSHCSKSFGRRTHYKRHLL 130
            ::...:.|.||:|..:...:..|                |..|...|:||.:.|........|..
Human    88 QTLGKESRGLRQQGTSVAQSGAQ----------------APGRAHRCAHCRRHFPGWVALWLHTR 136

  Fly   131 KHEKR-PHKCSHCSKTFTQNSSLKQHLHEHTGERP---FKCTQCSTSFARKSHLQVHLRTHS-EE 190
            :.:.| |..|..|.:.|.....|..|...|....|   |.|..|..||.....|.:|||.|| .:
Human   137 RCQARLPLPCPECGRRFRHAPFLALHRQVHAAATPDLGFACHLCGQSFRGWVALVLHLRAHSAAK 201

  Fly   191 RPFECTHCEKAFKNNSHLQEHL-RTH---QEARPFKCSHCSKSFKLRSILQKHLLTH-------- 243
            ||..|..||:.|.....|:.|| |.|   .|||||.|.:|.:||.....|..|...|        
Human   202 RPIACPKCERRFWRRKQLRAHLRRCHPPAPEARPFICGNCGRSFAQWDQLVAHKRVHVAEALEEA 266

  Fly   244 ------------------------AERSFKCTQCPKTFLQNDSLQIHLRVHAGEDPFKCPHCSET 284
                                    .:|.|:|..|.|.|....:|..|.|||.||.|.:||.|.:.
Human   267 AAKALGPRPRGRPAVTAPRPGGDAVDRPFQCACCGKRFRHKPNLIAHRRVHTGERPHQCPECGKR 331

  Fly   285 FARNSRLQLHLLEHAGKEPLKCSQCSATFAMRSLYRVHVRLHTRER------------------- 330
            |.....|..|...|.|::|..|.:|...|..:.....|.::|.|..                   
Human   332 FTNKPYLTSHRRIHTGEKPYPCKECGRRFRHKPNLLSHSKIHKRSEGSAQAAPGPGSPQLPAGPQ 396

  Fly   331 ------------------------------------QYKCAECSKSFFKKSHLVEHQQVHTGERP 359
                                                .|.|.:|.:||..:..|..||:.||||||
Human   397 ESAAEPTPAVPLKPAQEPPPGAPPEHPQDPIEAPPSLYSCDDCGRSFRLERFLRAHQRQHTGERP 461

  Fly   360 FKCTHCFKDFKCRTHLRVHMLDHIGEKVPKCSYCSKEFKLSSQLLVHLQEHTGKNQFECPHCSKS 424
            |.|..|.|:|..:|||..|...|.||:...|..|.:.|...|.|..|.::|.....|.||.|.|:
Human   462 FTCAECGKNFGKKTHLVAHSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPDRPFVCPDCGKA 526

  Fly   425 YTTSSTLHMHLRTHTGELPFKCSHCSKLFARSAEHQEHLRTHTGEKPYKCSHCSTRYTQKSSLGR 489
            :.....|..|.|.||||.|:.|..|.|.|::.:....|.|.||||:||.|..|...::|||:|..
Human   527 FRHKPYLAAHRRIHTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLIT 591

  Fly   490 HLRR---------TLCGTKSD 501
            |.:.         .:||...|
Human   592 HRKSHIRDGAFCCAICGQTFD 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5245NP_650197.1 COG5048 74..478 CDD:227381 142/499 (28%)
C2H2 Zn finger 84..104 CDD:275368 1/19 (5%)
C2H2 Zn finger 112..132 CDD:275368 5/19 (26%)
C2H2 Zn finger 139..159 CDD:275368 5/19 (26%)
C2H2 Zn finger 167..187 CDD:275368 8/19 (42%)
zf-H2C2_2 179..204 CDD:290200 12/25 (48%)
C2H2 Zn finger 195..215 CDD:275368 8/20 (40%)
C2H2 Zn finger 223..243 CDD:275368 6/19 (32%)
C2H2 Zn finger 250..270 CDD:275368 7/19 (37%)
C2H2 Zn finger 278..298 CDD:275368 6/19 (32%)
C2H2 Zn finger 306..326 CDD:275368 4/19 (21%)
C2H2 Zn finger 334..354 CDD:275368 7/19 (37%)
C2H2 Zn finger 362..382 CDD:275368 8/19 (42%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
C2H2 Zn finger 474..492 CDD:275368 7/17 (41%)
REPIN1NP_001374966.1 C2H2 Zn finger 118..138 CDD:275368 5/19 (26%)
C2H2 Zn finger 146..166 CDD:275368 5/19 (26%)
C2H2 Zn finger 177..197 CDD:275368 8/19 (42%)
COG5048 <197..371 CDD:227381 52/173 (30%)
C2H2 Zn finger 206..227 CDD:275368 8/20 (40%)
C2H2 Zn finger 238..258 CDD:275368 6/19 (32%)
COG5048 292..599 CDD:227381 94/306 (31%)
C2H2 Zn finger 297..317 CDD:275368 7/19 (37%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 353..373 CDD:275368 4/19 (21%)
C2H2 Zn finger 436..456 CDD:275368 7/19 (37%)
C2H2 Zn finger 464..484 CDD:275368 8/19 (42%)
C2H2 Zn finger 492..512 CDD:275368 6/19 (32%)
C2H2 Zn finger 520..540 CDD:275368 7/19 (37%)
C2H2 Zn finger 548..568 CDD:275368 6/19 (32%)
C2H2 Zn finger 576..596 CDD:275368 7/19 (37%)
C2H2 Zn finger 604..624 CDD:275368 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.