DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5245 and ZNF320

DIOPT Version :9

Sequence 1:NP_650197.1 Gene:CG5245 / 41530 FlyBaseID:FBgn0038047 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001338702.1 Gene:ZNF320 / 162967 HGNCID:13842 Length:509 Species:Homo sapiens


Alignment Length:340 Identity:143/340 - (42%)
Similarity:200/340 - (58%) Gaps:1/340 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LKQHLHEHTGERPFKCTQCSTSFARKSHLQVHLRTHSEERPFECTHCEKAFKNNSHLQEHLRTHQ 216
            |::|...||||:|:||.:|...|:.||||::|...|:.|:|::|..|:||||::|||.:|.|.|:
Human   148 LRRHRRIHTGEKPYKCEECEKVFSCKSHLEIHRIIHTGEKPYKCKVCDKAFKHDSHLAKHTRIHR 212

  Fly   217 EARPFKCSHCSKSFKLRSILQKHLLTH-AERSFKCTQCPKTFLQNDSLQIHLRVHAGEDPFKCPH 280
            ..:.:.|:.|.|.|..::.|..|..:| .|:.:||.:|.|||.|...|..|.|:|.||.|:||..
Human   213 GDKHYTCNECGKVFDQKATLACHHRSHTGEKPYKCNECGKTFSQTSHLVYHHRLHTGEKPYKCNE 277

  Fly   281 CSETFARNSRLQLHLLEHAGKEPLKCSQCSATFAMRSLYRVHVRLHTRERQYKCAECSKSFFKKS 345
            |.:||||||.|.:|...|..::|.||::|...|..|:....|.|:||.|:.|:|.||.|.|.:||
Human   278 CGKTFARNSVLVIHKAVHTAEKPYKCNECGKVFKQRATLAGHRRVHTGEKPYRCEECDKVFSRKS 342

  Fly   346 HLVEHQQVHTGERPFKCTHCFKDFKCRTHLRVHMLDHIGEKVPKCSYCSKEFKLSSQLLVHLQEH 410
            ||..|:::||||:|:||..|.|.|:..:.|..|...|.||:...|:.|.|.|...:.|..|.:.|
Human   343 HLERHRRIHTGEKPYKCKVCDKAFRSDSRLAEHQRVHTGERPYTCNECGKVFSTKAYLACHQKLH 407

  Fly   411 TGKNQFECPHCSKSYTTSSTLHMHLRTHTGELPFKCSHCSKLFARSAEHQEHLRTHTGEKPYKCS 475
            ||:..:||..|.|.|...|.|..|.|.||||.|.||..|.|.|...:....|.|.|||:|.|||.
Human   408 TGEKLYECEECDKVYIRKSHLERHRRIHTGEKPHKCGDCGKAFNSPSHLIRHQRIHTGQKSYKCH 472

  Fly   476 HCSTRYTQKSSLGRH 490
            .|...::.:|.|..|
Human   473 QCGKVFSLRSLLAEH 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5245NP_650197.1 COG5048 74..478 CDD:227381 139/326 (43%)
C2H2 Zn finger 84..104 CDD:275368
C2H2 Zn finger 112..132 CDD:275368
C2H2 Zn finger 139..159 CDD:275368 2/6 (33%)
C2H2 Zn finger 167..187 CDD:275368 8/19 (42%)
zf-H2C2_2 179..204 CDD:290200 11/24 (46%)
C2H2 Zn finger 195..215 CDD:275368 11/19 (58%)
C2H2 Zn finger 223..243 CDD:275368 6/19 (32%)
C2H2 Zn finger 250..270 CDD:275368 9/19 (47%)
C2H2 Zn finger 278..298 CDD:275368 10/19 (53%)
C2H2 Zn finger 306..326 CDD:275368 6/19 (32%)
C2H2 Zn finger 334..354 CDD:275368 10/19 (53%)
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
C2H2 Zn finger 418..438 CDD:275368 8/19 (42%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
C2H2 Zn finger 474..492 CDD:275368 5/17 (29%)
ZNF320NP_001338702.1 KRAB 7..48 CDD:396083
SFP1 <25..216 CDD:227516 31/67 (46%)
COG5048 147..483 CDD:227381 140/334 (42%)
C2H2 Zn finger 163..183 CDD:275368 8/19 (42%)
C2H2 Zn finger 191..211 CDD:275368 11/19 (58%)
C2H2 Zn finger 219..239 CDD:275368 6/19 (32%)
C2H2 Zn finger 247..267 CDD:275368 9/19 (47%)
C2H2 Zn finger 275..295 CDD:275368 10/19 (53%)
C2H2 Zn finger 303..323 CDD:275368 6/19 (32%)
C2H2 Zn finger 331..351 CDD:275368 10/19 (53%)
C2H2 Zn finger 359..379 CDD:275368 6/19 (32%)
C2H2 Zn finger 387..407 CDD:275368 6/19 (32%)
C2H2 Zn finger 415..435 CDD:275368 8/19 (42%)
C2H2 Zn finger 443..463 CDD:275368 6/19 (32%)
C2H2 Zn finger 471..490 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100020
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.