DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5245 and ZNF730

DIOPT Version :9

Sequence 1:NP_650197.1 Gene:CG5245 / 41530 FlyBaseID:FBgn0038047 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_016881603.1 Gene:ZNF730 / 100129543 HGNCID:32470 Length:514 Species:Homo sapiens


Alignment Length:463 Identity:155/463 - (33%)
Similarity:217/463 - (46%) Gaps:60/463 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CSY-GKDLEPVKGVPS--------KLKTCKSKIAKKRPLRKQTDTFKC--------TQCQKTFTR 93
            ||: .:||.|.:|:..        :.|.|:.:....|...|..|.||.        .||..|   
Human    89 CSHIAQDLWPEQGIKDYFQEVILRQYKKCRHENLLLRKGCKNVDEFKMHKKGYNRHNQCLTT--- 150

  Fly    94 KENLESHLRLHAEERPFECSHCSKSFGRRTHYKRHLLKH-EKRPHKCSHCSKTFTQNSSLKQHLH 157
                 ||.::      |:|....|.|.:.::..||.::| .|:|.||..|.|.|...|.|.||..
Human   151 -----SHSKI------FQCDKYVKVFHKFSNSNRHKIRHTSKKPFKCKECGKLFCILSHLAQHKK 204

  Fly   158 EHTGERPFKCTQCSTSFARKSHLQVHLRTHSEERPFECTHCEKAFKNNSHLQEHLRTHQEARPFK 222
            .||||:.:||.:...:|...|:...|.|. :|::|::|..|.|||...||...|.|.|...:|::
Human   205 IHTGEKSYKCEEYGKAFNESSNCTTHKRI-TEKKPYKCKECGKAFNWFSHFTTHKRIHTGEKPYQ 268

  Fly   223 CSHCSKSFKLRSILQKHLLTHAERSFKCTQCPKTFLQNDSLQIHLRVHAGEDPFKCPHCSETFAR 287
            |..|.|.|.                           |:.:|..|.|:|.||.|:||..|.:.|.:
Human   269 CEKCGKFFN---------------------------QSTNLTTHKRIHTGEKPYKCEECGKAFNQ 306

  Fly   288 NSRLQLHLLEHAGKEPLKCSQCSATFAMRSLYRVHVRLHTRERQYKCAECSKSFFKKSHLVEHQQ 352
            :|.|..|...|..::|.||.:|...|...|....|.|:|..|:.|||.||.|:|.:.|.|..|:.
Human   307 SSNLTEHKKIHTKEQPYKCEKCGKAFKWSSTLTKHKRIHNGEKPYKCEECGKAFNRSSTLNRHKI 371

  Fly   353 VHTGERPFKCTHCFKDFKCRTHLRVHMLDHIGEKVPKCSYCSKEFKLSSQLLVHLQEHTGKNQFE 417
            .|||.:|:|...|.|.|...:.|.:|.:.|..||..||..|.|.|...|.|..|.:.|||:..::
Human   372 THTGGKPYKYKECGKAFNQSSTLTIHKIIHTVEKFYKCEECGKAFSRISHLTTHKRIHTGEKPYK 436

  Fly   418 CPHCSKSYTTSSTLHMHLRTHTGELPFKCSHCSKLFARSAEHQEHLRTHTGEKPYKCSHCSTRYT 482
            |..|.:::..||||..|.|.||||.|::|..|.|.|.||:....|...|:|||.|||..|...:.
Human   437 CEECGRAFNQSSTLTTHKRIHTGEKPYECEECGKAFNRSSTLTTHKIIHSGEKIYKCKECGKAFR 501

  Fly   483 QKSSLGRH 490
            :.|.|.||
Human   502 RFSHLTRH 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5245NP_650197.1 COG5048 74..478 CDD:227381 141/412 (34%)
C2H2 Zn finger 84..104 CDD:275368 5/27 (19%)
C2H2 Zn finger 112..132 CDD:275368 5/19 (26%)
C2H2 Zn finger 139..159 CDD:275368 8/19 (42%)
C2H2 Zn finger 167..187 CDD:275368 5/19 (26%)
zf-H2C2_2 179..204 CDD:290200 9/24 (38%)
C2H2 Zn finger 195..215 CDD:275368 9/19 (47%)
C2H2 Zn finger 223..243 CDD:275368 4/19 (21%)
C2H2 Zn finger 250..270 CDD:275368 4/19 (21%)
C2H2 Zn finger 278..298 CDD:275368 6/19 (32%)
C2H2 Zn finger 306..326 CDD:275368 6/19 (32%)
C2H2 Zn finger 334..354 CDD:275368 8/19 (42%)
C2H2 Zn finger 362..382 CDD:275368 5/19 (26%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
C2H2 Zn finger 418..438 CDD:275368 8/19 (42%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
C2H2 Zn finger 474..492 CDD:275368 6/17 (35%)
ZNF730XP_016881603.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100020
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.