DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5641 and zfr

DIOPT Version :9

Sequence 1:NP_650196.1 Gene:CG5641 / 41529 FlyBaseID:FBgn0038046 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_012816329.1 Gene:zfr / 496597 XenbaseID:XB-GENE-6067390 Length:1084 Species:Xenopus tropicalis


Alignment Length:420 Identity:100/420 - (23%)
Similarity:180/420 - (42%) Gaps:80/420 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GRPMRGGIRPPFKKTFVPRHPFDLTLAEVFFPKVPSAGAVDDSALTAALLKRNQDLSPTPSEQTA 73
            |.|...|:||...    |:            |:.||.....||:....::.::..:.||..|..|
 Frog   705 GPPGLLGVRPGMP----PQ------------PQGPSPLRRPDSSDDRYVMTKHAAIYPTEEELQA 753

  Fly    74 IGNLVTKVQAVLDNLVVAPGDLTTCQLEE---------------VRQVGSFKKGTILTGNNVADV 123
            :..:|:..:..|..:..:..|....:.:|               |.:||...||.:|.|:....:
 Frog   754 VQKIVSLTERALKLVSDSMADQDKSKTKESDDKKEPSKERALKGVLRVGVLAKGLLLRGDRNVSL 818

  Fly   124 VVILKTLPTKEAVDALAKKVEADLKASM------KTEVLTKGDQHTVQIHERGFDIANVHAKVRI 182
            |::....||:    ||..::...|...:      |.||.....:..:.::      :.|..|:::
 Frog   819 VLLCAEKPTR----ALLSRITESLPKQLAVICPEKYEVSCSLAEAAIILN------SCVEPKMQV 873

  Fly   183 LIA-TLP----QNLR---------KLEPEIHLDHKLMQSHLAAIRHTRWFEENAHH-SSIKVLIR 232
            .|. |.|    :|||         |..|:: ||.:.....|||:||.:||:..|:. .|..::||
 Frog   874 TITLTSPVIREENLRDGDVTPGMVKDPPDV-LDRQKCLDALAALRHAKWFQARANGLQSCVIIIR 937

  Fly   233 ILKDLTRRFDAFSPLSAWMLDLIAHLAIMNNPSRQALPINLAFRRVFQLLSAGLFLPGSAGITDP 297
            ||:||.:|...:|...:|.|:|:...||.::...|: |.: |.||||:.:|:|:.|.|..|:.||
 Frog   938 ILRDLCQRVPTWSDFPSWALELLVEKAISSSSGPQS-PGD-ALRRVFECISSGIILKGGPGLLDP 1000

  Fly   298 TEPGHIRVHTAMTLEQQDVCCYTSQTLLRVLAHGGYKHILGLEGNTSVVREMSVWNGVCISPLTA 362
            .|.........|..:|::....::|..||:||......:||::..:.:.:..:|.|         
 Frog  1001 CEKDPYDTLATMNDQQREDITSSAQFALRLLAFRQIYKVLGMDPLSQMNQRFNVHN--------- 1056

  Fly   363 VYEKPTDKKEGDLEEDIDMIENENEEEGSD 392
                  ::|.....:.:|..|.|.:::..|
 Frog  1057 ------NRKRRRDSDGVDSFEAEGKKDKKD 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5641NP_650196.1 DZF 105..345 CDD:284860 73/260 (28%)
zfrXP_012816329.1 ZnF_U1 331..360 CDD:197732
C2H2 Zn finger 333..355 CDD:275371
ZnF_U1 384..413 CDD:197732
C2H2 Zn finger 384..406 CDD:275371
ZnF_U1 572..603 CDD:197732
C2H2 Zn finger 575..597 CDD:275371
DZF 794..1048 CDD:128842 74/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.