DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5641 and CG12493

DIOPT Version :9

Sequence 1:NP_650196.1 Gene:CG5641 / 41529 FlyBaseID:FBgn0038046 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_647927.3 Gene:CG12493 / 38575 FlyBaseID:FBgn0035571 Length:296 Species:Drosophila melanogaster


Alignment Length:204 Identity:38/204 - (18%)
Similarity:73/204 - (35%) Gaps:74/204 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KVPSAGAVDDSALTAA----------LLKRNQD-----LSPTPSEQTAIGNLVTKVQ---AVLDN 87
            |:|     ||:|:..:          .|||:|.     :.|.|...|:...|:...:   .::||
  Fly    52 KIP-----DDAAMATSDPKKKKKKVKKLKRSQKAKDRLVRPLPKAVTSKDALMVLKELKGVIIDN 111

  Fly    88 LVVAPGDLTTCQLEEVRQVGSFKKGTILTGNNVADVVVILKTLPTKEAVD------ALAKKVEAD 146
            :          |:::..:           |.|||::||..|....:.:.:      |..|.:...
  Fly   112 M----------QIKQDHE-----------GKNVANIVVNSKKYDAEGSSENSAGNAACEKALREI 155

  Fly   147 LKASMKT-----EVLTKGDQHTV----------QIHER----GFDIANVH-----AKVRILIATL 187
            |...||.     |..:.||:..:          ::.|:    ..|:|.::     .|....:..|
  Fly   156 LTTKMKALLAEPENSSGGDEDNILEKMTSYAVYKLAEKWNSDAIDVAALYNDVKNKKTSSSVGQL 220

  Fly   188 PQNLRKLEP 196
            |:..:.:.|
  Fly   221 PKLWKNMHP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5641NP_650196.1 DZF 105..345 CDD:284860 22/122 (18%)
CG12493NP_647927.3 DSRM 229..289 CDD:214634 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.