DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5641 and ILF3

DIOPT Version :9

Sequence 1:NP_650196.1 Gene:CG5641 / 41529 FlyBaseID:FBgn0038046 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001381737.1 Gene:ILF3 / 3609 HGNCID:6038 Length:898 Species:Homo sapiens


Alignment Length:382 Identity:100/382 - (26%)
Similarity:161/382 - (42%) Gaps:78/382 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LLKRNQDLSPTPSEQTAIGNLVTKV--------------------QAVLDNLVVAPGDLT----- 96
            ::.::..:.||..|..|:.|:|:..                    ||..||:.|.|.|.:     
Human    14 VMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAG 78

  Fly    97 -------TCQLEEVRQVGSFKKGTILTGNNVADVVVILKTLPTKEAVDALAKKVEADLKA--SMK 152
                   |..|..|.:||...||.:|.|:...::|::.|..||...:|.:|..:...|.|  ..|
Human    79 EQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAAVTEDK 143

  Fly   153 TEVL------------TKGDQHTVQIHERGFDIANVHAKVRILIATLPQNLRKLEPEIHLDHKLM 205
            .|:|            ||....::.||.....:.....|| :...||..|    :|...||.:..
Human   144 YEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEMEKV-LAGETLSVN----DPPDVLDRQKC 203

  Fly   206 QSHLAAIRHTRWFEENAHH-SSIKVLIRILKDLTRRFDAFSPLSAWMLDLIAHLAI--MNNPSRQ 267
            .:.||::||.:||:..|:. .|..::||:|:||..|...:.||..|.|:|:...:|  .|.|   
Human   204 LAALASLRHAKWFQARANGLKSCVIVIRVLRDLCTRVPTWGPLRGWPLELLCEKSIGTANRP--- 265

  Fly   268 ALPINLAFRRVFQLLSAGLFLPGSAGITDPTEP------GHIRVHTAMTLEQQDVCCYTSQTLLR 326
             :....|.|||.:.|::|:.:|..:||.||.|.      ||      :..:|::....::|..||
Human   266 -MGAGEALRRVLECLASGIVMPDGSGIYDPCEKEATDAIGH------LDRQQREDITQSAQHALR 323

  Fly   327 VLAHGGYKHILGLEGNTSVV-----REMSVWNGVCISPLTAVYEKPTDKKEGDLEED 378
            :.|.|....:||::...|.:     .|..|...|.|.|.|.....|..:   .:|||
Human   324 LAAFGQLHKVLGMDPLPSKMPKKPKNENPVDYTVQIPPSTTYAITPMKR---PMEED 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5641NP_650196.1 DZF 105..345 CDD:284860 73/262 (28%)
ILF3NP_001381737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..86 7/35 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..401 5/18 (28%)
Bipartite nuclear localization signal. /evidence=ECO:0000255 371..389 3/10 (30%)
Interaction with PRMT1. /evidence=ECO:0000269|PubMed:10749851 613..898
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 629..664
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 722..898
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.