DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5641 and loqs

DIOPT Version :9

Sequence 1:NP_650196.1 Gene:CG5641 / 41529 FlyBaseID:FBgn0038046 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster


Alignment Length:89 Identity:20/89 - (22%)
Similarity:31/89 - (34%) Gaps:32/89 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ALRGGRPMRGGIRPPFKKTFVPRHPFDLTLAEVFFPKVPSAGAVDDSALTAALLKRNQDLSPTPS 69
            ||.||..::||:                .|..|..|        .|.||        :.:|.|.:
  Fly    96 ALAGGSGLQGGV----------------GLMGVILP--------SDEAL--------KFVSETDA 128

  Fly    70 EQTAIGNLVTKVQAVLDNLVVAPG 93
            ...|:...|:.:|.:|....:.||
  Fly   129 NGLAMKTPVSILQELLSRRGITPG 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5641NP_650196.1 DZF 105..345 CDD:284860
loqsNP_609646.1 DSRM 136..204 CDD:214634 5/17 (29%)
DSRM 250..316 CDD:238007
DSRM 394..460 CDD:214634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.