DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5641 and zfr

DIOPT Version :9

Sequence 1:NP_650196.1 Gene:CG5641 / 41529 FlyBaseID:FBgn0038046 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_955852.2 Gene:zfr / 321659 ZFINID:ZDB-GENE-030131-378 Length:1074 Species:Danio rerio


Alignment Length:434 Identity:104/434 - (23%)
Similarity:180/434 - (41%) Gaps:102/434 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GRPMRGGIRPPFKKTFVPRHPFDLTLAEVFFPKVPSAGAVDDSALTAALLKRNQDLSPTPSEQTA 73
            |.|...|:||...   :|:            |:.|......||:....::.::..:.|:..|..|
Zfish   689 GPPGLLGVRPGMP---IPQ------------PQGPVPPRRPDSSDDRYVMTKHAAIYPSEDELQA 738

  Fly    74 IGNLVTKVQAVLDNLVVAPGDLTTCQ-----------------------LEEVRQVGSFKKGTIL 115
            |..:|:..:..| .||   .|:.|.|                       |:.|.:||...||.:|
Zfish   739 IQKIVSITERAL-KLV---SDIITDQDAGASAKGKEEDKEKKEPPKDRLLKGVMRVGVLAKGLLL 799

  Fly   116 TGNNVADVVVILKTLPTK----EAVDALAKKV------EADLKASMKTE--VLTK-GD---QHTV 164
            .|:...::|::....|||    ..|:.|.|::      :.::|.|::..  :||. ||   |.|:
Zfish   800 RGDKEVNLVLLCSEKPTKNLLTRIVEHLPKQLTMVTPEKYEVKGSIQESAIILTSCGDPKMQVTI 864

  Fly   165 QI--------HERGFDIANVHAKVRILIATLPQNLRKLEPEIHLDHKLMQSHLAAIRHTRWFEEN 221
            .:        ..|..|:.:...|               :|...||.:.....|||:||.:||:..
Zfish   865 TLTSPIIREESSRDGDVTSSMVK---------------DPADVLDRQKCLDALAALRHAKWFQAR 914

  Fly   222 AHH-SSIKVLIRILKDLTRRFDAFSPLSAWMLDLIAHLAIMNNPSRQALPINL--AFRRVFQLLS 283
            |:. .|..::||||:||.:|...:|...:|.::|:...||    |..:.|::.  |.||||:.:|
Zfish   915 ANGLQSCVIVIRILRDLCQRVPTWSAFPSWAMELLVEKAI----SSASGPMSPGDALRRVFECIS 975

  Fly   284 AGLFLPGSAGITDPTEPGHIRVHTAMTLEQQDVCCYTSQTLLRVLAHGGYKHILGLEGNTSVVRE 348
            :|:.|.|:.|:.||.|.........|..:|::....::|..||:||......:||::....:...
Zfish   976 SGILLSGAPGLIDPCEKNPTDTLAFMEEQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQMNSR 1040

  Fly   349 MSVWNGVCISPLTAVYEKPTDKKEGDLEEDIDMIENENEEEGSD 392
            .:|.|              |.|:..|..:..|..|.|.:::..|
Zfish  1041 FNVRN--------------TRKRRRDNSDGADGFEAEGKKDKKD 1070

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5641NP_650196.1 DZF 105..345 CDD:284860 72/266 (27%)
zfrNP_955852.2 ZnF_U1 324..353 CDD:197732
C2H2 Zn finger 326..348 CDD:275371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..374
ZnF_U1 380..409 CDD:197732
C2H2 Zn finger 380..402 CDD:275371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 412..456
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..545
ZnF_U1 575..606 CDD:197732
C2H2 Zn finger 578..600 CDD:275371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 697..718 7/35 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 761..781 0/19 (0%)
DZF 784..1037 CDD:128842 74/271 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1036..1074 9/49 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.