DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5641 and Zfr2

DIOPT Version :9

Sequence 1:NP_650196.1 Gene:CG5641 / 41529 FlyBaseID:FBgn0038046 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_038936366.1 Gene:Zfr2 / 314639 RGDID:1304737 Length:842 Species:Rattus norvegicus


Alignment Length:341 Identity:86/341 - (25%)
Similarity:150/341 - (43%) Gaps:46/341 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 AGAVDDSALTAALLKRNQDLSPTPSE----QTAIGNLVTKVQAVLDNLVVAPGDLTTC------Q 99
            :|...:|:....::.::..:.||..|    |||:.:....::.|.|.|........|.      .
  Rat   493 SGRRPESSDDRHVMYKHASIYPTEEELQAIQTAVSHTERALRLVSDTLAEESSQQGTLVSPPPRM 557

  Fly   100 LEEVRQVGSFKKGTILTGNNVADVVVILKTLPTKEAVDALAKKV--EADLKASMKTEVLTKGDQH 162
            |:.|.:||...||.:|.|::...:.::....||...:..:.:::  |..:.|..|.||.:..|.:
  Rat   558 LKGVVRVGILAKGLVLRGDHSVQLTLLCSKKPTHSLLQRIKQELPRELSIVAEDKYEVSSDHDAN 622

  Fly   163 TVQIHERGFDIANVHAKVRILI-ATLP---------QNLRK--LEPEIHLDHKLMQSHLAAIRHT 215
            .|       ..|.|...|::.: ||.|         |.|:.  .:||..||.:.....|||:||.
  Rat   623 IV-------ISACVEPGVKVTVSATSPLMREDPSVKQELQDSLSDPEDILDRERCLETLAALRHA 680

  Fly   216 RWFEENAHHSSIK---VLIRILKDLTRRFDAFSPLSAWMLDLIAHLAIMNNPSRQALPINLAFRR 277
            :||:..|  |.::   ::||:|:||.|....:..|.||.::|:....:.:.|  :.|....|.||
  Rat   681 KWFQARA--SGLQPCVIVIRVLRDLCRCLPPWGALPAWAMELLVEKVLSSAP--RPLSPGDAMRR 741

  Fly   278 VFQLLSAGLFLPGSAGITDPTEPGHIRVHTAMTLEQQDVCCYTSQTLLRVLAHGGYKHILGLE-- 340
            |.:.::.|..|....|:.||.|.|.......||.:|::....::|..||::|......:|.:|  
  Rat   742 VLEYVATGALLTDGPGLQDPCEKGPQDALEPMTPQQREDLTASAQHALRLVAFRQIHKVLHMEHL 806

  Fly   341 ------GNTSVVREMS 350
                  |....:||.|
  Rat   807 PPRTRFGARKRMREAS 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5641NP_650196.1 DZF 105..345 CDD:284860 69/264 (26%)
Zfr2XP_038936366.1 PHA03247 <20..310 CDD:223021
ZnF_U1 177..204 CDD:197732
C2H2 Zn finger 179..225 CDD:275371
ZnF_U1 224..255 CDD:197732
C2H2 Zn finger 226..248 CDD:275371
zf-met 372..396 CDD:403930
C2H2 Zn finger 374..396 CDD:275371
DZF 558..809 CDD:295427 70/261 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.