DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5641 and Adar

DIOPT Version :9

Sequence 1:NP_650196.1 Gene:CG5641 / 41529 FlyBaseID:FBgn0038046 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001368969.1 Gene:Adar / 31130 FlyBaseID:FBgn0026086 Length:681 Species:Drosophila melanogaster


Alignment Length:188 Identity:33/188 - (17%)
Similarity:64/188 - (34%) Gaps:49/188 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PFK-KTFVPRHPFDLTL----AEVFFPKVPSAGAVDDSALTAALLKRNQDLSPTPSEQTAIGNLV 78
            |:| |:.|..|.:..|.    |.:|.|.....|.               |..|   .:.|.|.|.
  Fly   417 PYKLKSGVHFHLYINTAPCGDARIFSPHENDTGV---------------DKHP---NRKARGQLR 463

  Fly    79 TKVQAVLDNLVVAPGDLTTCQLEEVRQVGSFKKGTILTGNNVADVVVILKTLPTKEAVDALAKKV 143
            ||:::....:.|...|                      |....|.|:..:.|.|....|.:|:..
  Fly   464 TKIESGEGTIPVKSSD----------------------GIQTWDGVLQGQRLLTMSCSDKIARWN 506

  Fly   144 EADLKASMKTEVLTKGDQHTVQIHERGFDIANVHAKVRILIATLPQNLRKLEPEIHLD 201
            ...::.|:.:.::.....|::.:.    .:.:.....|.:...:.::::.|.|..||:
  Fly   507 IVGIQGSLLSSIIEPVYLHSIVLG----SLLHPEHMYRAVCGRIEKSIQGLPPPYHLN 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5641NP_650196.1 DZF 105..345 CDD:284860 14/97 (14%)
AdarNP_001368969.1 DSRM_STRBP_RED-like_rpt1 105..167 CDD:380694
DSRM_SF 213..>259 CDD:412133
ADEAMc 306..677 CDD:214718 33/188 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.