DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5641 and Adarb1

DIOPT Version :9

Sequence 1:NP_650196.1 Gene:CG5641 / 41529 FlyBaseID:FBgn0038046 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_006256337.1 Gene:Adarb1 / 25367 RGDID:2033 Length:775 Species:Rattus norvegicus


Alignment Length:375 Identity:82/375 - (21%)
Similarity:123/375 - (32%) Gaps:137/375 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IRPPFKKTFVPR----HPFDLTLAEV----FF------PKVPSAGAVDDSALTAALLKRNQDLSP 66
            :||..|..|:..    |.....::.|    ||      .|:..|.|. .|||....   |..|..
  Rat   307 LRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAA-QSALATVF---NLHLDQ 367

  Fly    67 TPSEQTAIG-----NLVTKVQAVLDNLVVAP-GDLTT--CQLEEVRQVGSFKKGTIL-TGNNVAD 122
            |||.|..:.     :|...:...:..||:.. .|||.  ......|:|.|   |.:: ||.:|.|
  Rat   368 TPSRQPVLSEGLQLHLPQVLADAVSRLVLGKFSDLTDNFSSPHARRKVLS---GVVMTTGTDVKD 429

  Fly   123 VVVILKTLPTKEAVDALAKKVEADLKASMKTEVLTKGDQHTVQIHERGFDIANVHAKV------- 180
            ..||..:..||                      ...|:    .:.:||..:.:.||::       
  Rat   430 AKVISVSTGTK----------------------CINGE----YMSDRGLALNDCHAEIISRRSLL 468

  Fly   181 RILIATLPQNLRKLEPEIHLDHKLMQSHLAAIRHTRWFEENAHHSSIKVLIRILKDLTRRFDAFS 245
            |.|.|.|         |::|::|..|            :::....|.:...| ||| |.:|    
  Rat   469 RFLYAQL---------ELYLNNKEDQ------------KKSIFQKSERGGFR-LKD-TVQF---- 506

  Fly   246 PLSAWMLDLIAHLAIMNNPSRQALPINLAFRRVF---QLLSAGLFLPGSAGITDPTEPGHIRVHT 307
                       ||.|..:|...|        |:|   :.:..|: .|.|..:|:|.:.     |.
  Rat   507 -----------HLYISTSPCGDA--------RIFSPHEPVLEGM-APDSHQLTEPADR-----HP 546

  Fly   308 AMTLEQQDVCCYTSQTLLRVLAHGGYKHILGLEGNTSVVREMSV--WNGV 355
            ......|          ||.....|       ||...|....|:  |:||
  Rat   547 NRKARGQ----------LRTKIESG-------EGTIPVRSNASIQTWDGV 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5641NP_650196.1 DZF 105..345 CDD:284860 50/250 (20%)
Adarb1XP_006256337.1 DSRM 143..206 CDD:238007
DSRM 299..357 CDD:238007 12/50 (24%)
ADEAMc 386..772 CDD:214718 61/292 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.