DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5641 and ZFR2

DIOPT Version :9

Sequence 1:NP_650196.1 Gene:CG5641 / 41529 FlyBaseID:FBgn0038046 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_011526133.1 Gene:ZFR2 / 23217 HGNCID:29189 Length:940 Species:Homo sapiens


Alignment Length:352 Identity:86/352 - (24%)
Similarity:152/352 - (43%) Gaps:73/352 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PKVPSAGAVDDSALTAA-----LLKRNQDLSPTPSE----QTAIGNLVTKVQAVLDNLV------ 89
            |:.|::..:......|:     ::.::..:.||..|    |.|:.:....::.|.|.|.      
Human   571 PESPASAPLQPGRRPASSDDRHVMCKHATIYPTEQELLAVQRAVSHAERALKLVSDTLAEEDRGR 635

  Fly    90 ----------VAPGDLTTCQLEEVRQVGSFKKGTILTGNNVADVVVILKTLPTKEAVDALAKKVE 144
                      |||   .|..|:.|.:||...||.:|.|:....:.::....||...:..:|:::.
Human   636 REEEGDKRSSVAP---QTRVLKGVMRVGILAKGLLLRGDRNVRLALLCSEKPTHSLLRRIAQQLP 697

  Fly   145 ADLKASMKTEVLTKGDQHTVQIHERGFDIANV------HAKVRILI-----------ATLPQNLR 192
            ..|:  |.||     |::.|.....    ||:      ..::::.|           :|.|:.:.
Human   698 RQLQ--MVTE-----DEYEVSSDPE----ANIVISSCEEPRMQVTISVTSPLMREDPSTDPEGVE 751

  Fly   193 KLEPEIH----LDHKLMQSHLAAIRHTRWFEENAHHSSIK---VLIRILKDLTRRFDAFSPLSAW 250
              ||:..    |..|.....|||:||.|||:..|  |.::   ::||:|:||.||...:..|.||
Human   752 --EPQADAGDVLSPKKCLESLAALRHARWFQARA--SGLQPCVIVIRVLRDLCRRVPTWGALPAW 812

  Fly   251 MLDLIAHLAIMNNPSRQALPINL--AFRRVFQLLSAGLFLPGSAGITDPTEPGHIRVHTAMTLEQ 313
            .::|:...|:    |..|.|:..  |.|||.:.::.|..|....|:.||.|.........|||::
Human   813 AMELLVEKAV----SSAAGPLGPGDAVRRVLECVATGTLLTDGPGLQDPCERDQTDALEPMTLQE 873

  Fly   314 QDVCCYTSQTLLRVLAHGGYKHILGLE 340
            ::....::|..||:||......:||::
Human   874 REDVTASAQHALRMLAFRQTHKVLGMD 900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5641NP_650196.1 DZF 105..345 CDD:284860 69/262 (26%)
ZFR2XP_011526133.1 ZnF_U1 271..300 CDD:197732
C2H2 Zn finger 273..295 CDD:275371
ZnF_U1 318..350 CDD:197732
C2H2 Zn finger 321..343 CDD:275371
ZnF_U1 467..498 CDD:197732
C2H2 Zn finger 470..492 CDD:275371
DZF 652..905 CDD:128842 71/268 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.