DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5641 and Ilf3

DIOPT Version :9

Sequence 1:NP_650196.1 Gene:CG5641 / 41529 FlyBaseID:FBgn0038046 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_011240705.1 Gene:Ilf3 / 16201 MGIID:1339973 Length:916 Species:Mus musculus


Alignment Length:382 Identity:96/382 - (25%)
Similarity:159/382 - (41%) Gaps:78/382 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LLKRNQDLSPTPSEQTAIGNLVTKVQAVL--------------------DNLVVAPGDLT----- 96
            ::.::..:.||..|..|:.|:|:..:..|                    :|:...|.|.:     
Mouse    32 VMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGNSELSEAENMDTPPDDESKEGAG 96

  Fly    97 -------TCQLEEVRQVGSFKKGTILTGNNVADVVVILKTLPTKEAVDALAKKVEADLK--ASMK 152
                   |..|..|.:||...||.:|.|:...::|::.|..||...:|.:|..:...|.  ...|
Mouse    97 EQKAEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLTTVTEDK 161

  Fly   153 TEVL------------TKGDQHTVQIHERGFDIANVHAKVRILIATLPQNLRKLEPEIHLDHKLM 205
            .|:|            ||....::.||.....:.....|| :...||..|    :|...||.:..
Mouse   162 YEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEMEKV-LAGETLSVN----DPPDVLDRQKC 221

  Fly   206 QSHLAAIRHTRWFEENAHH-SSIKVLIRILKDLTRRFDAFSPLSAWMLDLIAHLAI--MNNPSRQ 267
            .:.||::||.:||:..|:. .|..::||:|:||..|...:.||..|.|:|:...:|  .|.|   
Mouse   222 LAALASLRHAKWFQARANGLKSCVIVIRVLRDLCTRVPTWGPLRGWPLELLCEKSIGTANRP--- 283

  Fly   268 ALPINLAFRRVFQLLSAGLFLPGSAGITDPTEP------GHIRVHTAMTLEQQDVCCYTSQTLLR 326
             :....|.|||.:.|::|:.:|..:||.||.|.      ||      :..:|::....::|..||
Mouse   284 -MGAGEALRRVLECLASGIVMPDGSGIYDPCEKEATDAIGH------LDRQQREDITQSAQHALR 341

  Fly   327 VLAHGGYKHILGLEGNTSVV-----REMSVWNGVCISPLTAVYEKPTDKKEGDLEED 378
            :.|.|....:||::...|.:     .|..|...|.|.|.|.....|..:   .:|||
Mouse   342 LAAFGQLHKVLGMDPLPSKMPKKPKNENPVDYTVQIPPSTTYAITPMKR---PMEED 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5641NP_650196.1 DZF 105..345 CDD:284860 72/262 (27%)
Ilf3XP_011240705.1 DZF 106..360 CDD:128842 74/268 (28%)
DSRM_ILF3_rpt1 416..488 CDD:380739
DSRM_ILF3_rpt2 538..609 CDD:380741
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.