DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17202 and mycbp

DIOPT Version :9

Sequence 1:NP_650194.1 Gene:CG17202 / 41526 FlyBaseID:FBgn0038043 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001035140.1 Gene:mycbp / 677757 ZFINID:ZDB-GENE-060331-97 Length:104 Species:Danio rerio


Alignment Length:114 Identity:33/114 - (28%)
Similarity:64/114 - (56%) Gaps:15/114 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKPIDPKRDEIRRYLERGSVLDSLTKLFIRVIK--ERPENPMDYIRNHIGVVRHQHDKYERLQQD 65
            ::..:.||::.|||||:..||||||.:.:.:.:  |:|.|.:|:|::|:||...:.:..|.|:::
Zfish     4 YRASESKREQFRRYLEKAGVLDSLTNVLVALYEETEKPNNALDFIKHHLGVSGVEAEDAESLREE 68

  Fly    66 LQLANEEIQRLRAIINGINPDVLQGHQPVASSEVVVATEAPQTVAESTE 114
            |....::.|:|           ::.:|.:.|.  ::..|.||..|.:.|
Zfish    69 LNTLQQKHQQL-----------MEENQELKSR--LLQYEPPQDEAAAVE 104



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5419
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1497203at2759
OrthoFinder 1 1.000 - - FOG0008114
OrthoInspector 1 1.000 - - oto40380
orthoMCL 1 0.900 - - OOG6_103096
Panther 1 1.100 - - LDO PTHR13168
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10318
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.