DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17202 and Mycbp

DIOPT Version :9

Sequence 1:NP_650194.1 Gene:CG17202 / 41526 FlyBaseID:FBgn0038043 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_062634.2 Gene:Mycbp / 56309 MGIID:1891750 Length:103 Species:Mus musculus


Alignment Length:88 Identity:31/88 - (35%)
Similarity:53/88 - (60%) Gaps:15/88 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKPIDPKRDEIRRYLERGSVLDSLTKLFIRVIKERPENP---MDYIRNHIGVVRHQHDKYERLQQ 64
            :|..|.||::.|||||:..|||:|||:.: .:.|.||.|   :|::::|:|....::.:.|.|: 
Mouse     4 YKAADSKREQFRRYLEKSGVLDTLTKVLV-ALYEEPEKPTSALDFLKHHLGAATPENPEIELLR- 66

  Fly    65 DLQLAN---------EEIQRLRA 78
             |:||.         ||.::|:|
Mouse    67 -LELAEMKEKYEATVEENKKLKA 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17202NP_650194.1 None
MycbpNP_062634.2 ZIP_MycBP-like 42..94 CDD:409277 12/49 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BYY8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7176
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103096
Panther 1 1.100 - - LDO PTHR13168
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.