DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17202 and mycbp

DIOPT Version :9

Sequence 1:NP_650194.1 Gene:CG17202 / 41526 FlyBaseID:FBgn0038043 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001017035.1 Gene:mycbp / 549789 XenbaseID:XB-GENE-490310 Length:106 Species:Xenopus tropicalis


Alignment Length:101 Identity:31/101 - (30%)
Similarity:52/101 - (51%) Gaps:17/101 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SFKPIDPKRDEIRRYLERGSVLDSLTKLFIRVIK--ERPENPMDYIRNHIGVVRHQHDKYE---- 60
            ::|..|.||::.|||||:..|||:|||:.:.:.:  |:|.|.:|:::.|:|....:....|    
 Frog     3 NYKAADSKREQFRRYLEKAGVLDTLTKVLVALYEEPEKPNNALDFLKQHMGAAGPETADVEALRL 67

  Fly    61 ---RLQQDLQLANEEIQRLRAIINGINPDVLQGHQP 93
               .|:|..:...||.:.|:|        .|..|.|
 Frog    68 EVAELKQKYEAVLEENKELKA--------KLAQHDP 95



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1497203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13168
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10318
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.