DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17202 and CG4546

DIOPT Version :9

Sequence 1:NP_650194.1 Gene:CG17202 / 41526 FlyBaseID:FBgn0038043 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_650501.1 Gene:CG4546 / 41922 FlyBaseID:FBgn0038373 Length:457 Species:Drosophila melanogaster


Alignment Length:134 Identity:34/134 - (25%)
Similarity:64/134 - (47%) Gaps:34/134 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IDPKRDEIRRYLERGSVLDSLTKLFIRVIKE--RPENPMDYIRNHIGVVRHQHDKYERLQQDLQL 68
            |:.||.:.|:||||..|:|:|:|..|::.:|  :||:.:.::|..:........:|:.::.||:.
  Fly     4 IESKRVQYRKYLERAGVIDALSKALIKLYEEQNKPEDAIRFVRKFMCESCPDDAQYDVMKNDLEE 68

  Fly    69 A-------NEEIQRLRAIINGINPDVLQ-----GHQPVASSE-------------------VVVA 102
            |       .:|::|||..|.. :|:..|     |::.:...|                   ::|.
  Fly    69 AKTHISKLEQELERLRGQIKK-SPEEYQELTTEGYKSLMDDEENVSSLLRKYLTPELLEEYMLVT 132

  Fly   103 TEAP 106
            |.||
  Fly   133 TPAP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17202NP_650194.1 None
CG4546NP_650501.1 arginine_kinase_like 89..450 CDD:153079 8/49 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7176
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.