DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17202 and MYCBP

DIOPT Version :9

Sequence 1:NP_650194.1 Gene:CG17202 / 41526 FlyBaseID:FBgn0038043 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_036465.2 Gene:MYCBP / 26292 HGNCID:7554 Length:103 Species:Homo sapiens


Alignment Length:94 Identity:30/94 - (31%)
Similarity:56/94 - (59%) Gaps:13/94 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKPIDPKRDEIRRYLERGSVLDSLTKLFIRVIK--ERPENPMDYIRNHIGVVRHQHDKYERLQQD 65
            :|..|.||::.|||||:..|||:|||:.:.:.:  |:|.:.:|::::|:|....::.:.|.|:  
Human     4 YKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLR-- 66

  Fly    66 LQLAN---------EEIQRLRAIINGINP 85
            |:||.         ||.::|:|.:....|
Human    67 LELAEMKEKYEAIVEENKKLKAKLAQYEP 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17202NP_650194.1 None
MYCBPNP_036465.2 ZIP_MycBP-like 42..94 CDD:409277 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BYY8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1497203at2759
OrthoFinder 1 1.000 - - FOG0008114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103096
Panther 1 1.100 - - LDO PTHR13168
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10318
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.