DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scgbeta and Sgcb

DIOPT Version :9

Sequence 1:NP_524327.1 Gene:Scgbeta / 41525 FlyBaseID:FBgn0038042 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001177997.1 Gene:Sgcb / 680229 RGDID:1594202 Length:320 Species:Rattus norvegicus


Alignment Length:313 Identity:86/313 - (27%)
Similarity:144/313 - (46%) Gaps:78/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RLH-PGHQGRNTFAFWTIVVLLLVLTVGNLLLTLTIVGVLRLG-KGVQGMEVIPEVDLVKFYGTT 128
            ||| .|.:||.......::|||.:|.|.|||:||.|..|:|:| .|...:| ..|..|::|    
  Rat    53 RLHKTGLRGRKGNLAICVIVLLFILAVINLLITLVIWAVIRIGPNGCDSLE-FHESGLLRF---- 112

  Fly   129 DLERVQTNSIGQIHGFSDVPVTISSDAGDGEGGVHVRVFRNGNGAASERDRIVLNREGILVQATN 193
                .|.:.:|.||     |:..|:..|.          ||.|...:..::.::.::|    .|.
  Rat   113 ----KQVSDMGIIH-----PLYKSTVGGR----------RNENLVITGNNQPIVFQQG----TTK 154

  Fly   194 LFEVK--------------DPVDKQPIFTT--HRPQYNIPGGVEALQAKVVSASGIVSPIDESLV 242
            |...|              ||..:..:|:|  ...::::|.||::|..:..|...|.|.....|.
  Rat   155 LSVEKNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVKSLNVQKASTERITSNATSDLN 219

  Fly   243 LESDGRMAIRGSEGVYFDG--------ASVDMQAEHHILINSTQGATILEAGTGIFLDMDRIPIV 299
            ::.|||..:||:|||:..|        ..|:::||:.|::|.|           :.:...|:|  
  Rat   220 IKVDGRAIVRGNEGVFIMGKTIEFHMRGDVELKAENSIILNGT-----------VMVSPTRLP-- 271

  Fly   300 SSELGLRTGS---VQYKICVCMPHGTLFRIAIPRVHNGPKITCAHFSGKDDPC 349
            ||..|.::||   |:||:|:| ..||||::.:...:.|.:::       |:||
  Rat   272 SSSGGDQSGSGDWVRYKLCMC-ADGTLFKVQVTSHNMGCQVS-------DNPC 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScgbetaNP_524327.1 Sarcoglycan_1 73..330 CDD:282624 78/284 (27%)
SgcbNP_001177997.1 Sarcoglycan_1 61..304 CDD:282624 78/284 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336018
Domainoid 1 1.000 79 1.000 Domainoid score I8523
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5095
OMA 1 1.010 - - QHG49828
OrthoDB 1 1.010 - - D1214843at2759
OrthoFinder 1 1.000 - - FOG0007356
OrthoInspector 1 1.000 - - oto97019
orthoMCL 1 0.900 - - OOG6_108106
Panther 1 1.100 - - LDO PTHR21142
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.