DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scgbeta and Sgcb

DIOPT Version :9

Sequence 1:NP_524327.1 Gene:Scgbeta / 41525 FlyBaseID:FBgn0038042 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_036020.1 Gene:Sgcb / 24051 MGIID:1346523 Length:320 Species:Mus musculus


Alignment Length:313 Identity:87/313 - (27%)
Similarity:143/313 - (45%) Gaps:78/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RLH-PGHQGRNTFAFWTIVVLLLVLTVGNLLLTLTIVGVLRLG-KGVQGMEVIPEVDLVKFYGTT 128
            ||| .|.:||.......::|||.:|.|.|||:||.|..|:|:| .|...|| ..|..|::|    
Mouse    53 RLHKTGLRGRKGNLAICVIVLLFILAVINLLITLVIWAVIRIGPNGCDSME-FHESGLLRF---- 112

  Fly   129 DLERVQTNSIGQIHGFSDVPVTISSDAGDGEGGVHVRVFRNGNGAASERDRIVLNREGILVQATN 193
                .|.:.:|.||     |:..|:..|.          ||.|...:..::.::.::|    .|.
Mouse   113 ----KQVSDMGVIH-----PLYKSTVGGR----------RNENLVITGNNQPIVFQQG----TTK 154

  Fly   194 LFEVK--------------DPVDKQPIFTT--HRPQYNIPGGVEALQAKVVSASGIVSPIDESLV 242
            |...|              ||.....:|:|  ...::::|.||::|..:..|...|.|.....|.
Mouse   155 LSVEKNKTSITSDIGMQFFDPRTHNILFSTDYETHEFHLPSGVKSLNVQKASTERITSNATSDLN 219

  Fly   243 LESDGRMAIRGSEGVYF--------DGASVDMQAEHHILINSTQGATILEAGTGIFLDMDRIPIV 299
            ::.|||..:||:|||:.        .|..|:::||:.|::|.|           :.:...|:|  
Mouse   220 IKVDGRAIVRGNEGVFIMGKTIEFHMGGDVELKAENSIILNGT-----------VMVSPTRLP-- 271

  Fly   300 SSELGLRTGS---VQYKICVCMPHGTLFRIAIPRVHNGPKITCAHFSGKDDPC 349
            ||..|.::||   |:||:|:| ..||||::.:...:.|.:::       |:||
Mouse   272 SSSSGDQSGSGDWVRYKLCMC-ADGTLFKVQVTGHNMGCQVS-------DNPC 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScgbetaNP_524327.1 Sarcoglycan_1 73..330 CDD:282624 79/284 (28%)
SgcbNP_036020.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Sarcoglycan_1 61..302 CDD:282624 79/282 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832361
Domainoid 1 1.000 80 1.000 Domainoid score I8627
eggNOG 1 0.900 - - E1_28NAP
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5172
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49828
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007356
OrthoInspector 1 1.000 - - oto93480
orthoMCL 1 0.900 - - OOG6_108106
Panther 1 1.100 - - LDO PTHR21142
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4347
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.