DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pps and AT4G18720

DIOPT Version :9

Sequence 1:NP_001247075.1 Gene:pps / 41524 FlyBaseID:FBgn0082831 Length:2018 Species:Drosophila melanogaster
Sequence 2:NP_193607.1 Gene:AT4G18720 / 827606 AraportID:AT4G18720 Length:266 Species:Arabidopsis thaliana


Alignment Length:289 Identity:66/289 - (22%)
Similarity:109/289 - (37%) Gaps:79/289 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1123 KKNKKKDLFEDVLRQADTVSKVERINVFERKSGRVITGHMAPSAHQFRKWLQENPSFEVLPSGTV 1187
            :|.:..:|||..||.|.:|...|.                :|...:|                  
plant     2 QKREFMELFEAALRAAKSVKGDEN----------------SPEVSRF------------------ 32

  Fly  1188 QSADAEKRLLKGAPEAATSTSEPAVLGVAKKPPEGPAK---LSHPQNTTVQASHQLGISSVRPL- 1248
              .||..| ||.||::       .|..|..|...|...   :.| :|..:::..::    :|.| 
plant    33 --VDAMNR-LKEAPKS-------LVCDVVCKTSMGQGLEFFIDH-KNPKIRSEGRI----LRDLW 82

  Fly  1249 --------AKKDKEKTTPTVQAP---TPNRIAAGKPEPVRIGIRRSLREQLLARIKEAQAAEENS 1302
                    .:|.::.....|:.|   |..:....|.:.|     |.:.:..||::.......|..
plant    83 MKFFYASGREKSRDNREAAVKIPTHATMKKTGDSKRDKV-----REILQTSLAKVASEVVDTEMK 142

  Fly  1303 GQPTTQWPTVLEVDQFVKNVELEMFNSFGRDVGAKYKAKYRSLMFNIKDRKNRTLFEKICAKQVE 1367
            .:.|...|.|:.|     :||..||.:.|..:|.: ||||||::||:.|..|..|..|:...::.
plant   143 TRVTACDPWVVAV-----SVETAMFENLGCFMGPQ-KAKYRSILFNMGDSNNPDLRRKVLLGEIS 201

  Fly  1368 PRQLVRMTPEQLASQELAKWREEENRHQL 1396
            ..:||:|..|::.|    .|.....|:.|
plant   202 GERLVKMEKEEMGS----SWYTNSRRNPL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppsNP_001247075.1 TNG2 <827..965 CDD:227367
PHD_PHF3_like 914..963 CDD:277027
BRK 1142..1186 CDD:197800 3/43 (7%)
TFIIS_M 1274..1396 CDD:284835 34/121 (28%)
SPOC 1623..1729 CDD:285043
AT4G18720NP_193607.1 TFIIS_I 11..87 CDD:238107 23/124 (19%)
TFS2M 119..224 CDD:128786 33/119 (28%)
PKc_like <231..248 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.