DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pps and AT3G29639

DIOPT Version :9

Sequence 1:NP_001247075.1 Gene:pps / 41524 FlyBaseID:FBgn0082831 Length:2018 Species:Drosophila melanogaster
Sequence 2:NP_001078223.1 Gene:AT3G29639 / 5008042 AraportID:AT3G29639 Length:181 Species:Arabidopsis thaliana


Alignment Length:108 Identity:24/108 - (22%)
Similarity:39/108 - (36%) Gaps:52/108 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly  1239 QLGISSVRPLAKKDKEKTTPTVQAPTPNRIAAGKPEPVRIGIRRSLREQLLARIKEAQAAEENSG 1303
            ||.:|||.|:|                             ||           .|..:.||    
plant     6 QLSMSSVVPVA-----------------------------GI-----------FKSGEKAE---- 26

  Fly  1304 QPTTQWPTVLEVDQFVKNVELEMFNSFGRDVGAKYKAKYRSLM 1346
              |::||.::||.:.|:      .:.||:.:....|::.|:||
plant    27 --TSEWPAMVEVKRRVR------LSGFGKFIQELPKSRTRALM 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppsNP_001247075.1 TNG2 <827..965 CDD:227367
PHD_PHF3_like 914..963 CDD:277027
BRK 1142..1186 CDD:197800
TFIIS_M 1274..1396 CDD:284835 17/73 (23%)
SPOC 1623..1729 CDD:285043
AT3G29639NP_001078223.1 SPOC 4..>63 CDD:285043 24/108 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1634
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.