DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and AKR2

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_014677.1 Gene:AKR2 / 854199 SGDID:S000005560 Length:749 Species:Saccharomyces cerevisiae


Alignment Length:279 Identity:59/279 - (21%)
Similarity:101/279 - (36%) Gaps:67/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FLLLSTLATFNYVMATLTGPGLMP------------KQWHPKDPKDAQFLQYCKKCEGYKAPRSH 105
            ||:.|.|....::....:.||.:.            ||.......|.:  .:|.:....|..||.
Yeast   398 FLVTSFLTVVLFLRLVRSDPGCLKTDDSLTSIQETIKQLIDLGKFDRE--NFCVETLERKPLRSK 460

  Fly   106 HCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYF--------LLFSILGSLQGTVVLCCSFWRGI 162
            :.......|.:.||:||||.:.||..||..|.:|        .||         :.||.::::..
Yeast   461 YSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTVQYHMFLF---------MWLCLAYFKKT 516

  Fly   163 YRYYYLTHGLAHLASVQFTLLSIIMC----------ILGMGLAIGVVIGLSMLLFIQLKTIVNNQ 217
            ...|......|..|    .|.:..:|          .|.:.:::. .|.|..:|.:|...|:...
Yeast   517 NYIYEQVEEYARCA----LLKNETLCKGSNYDPSTFFLFIWISVN-FIWLGAMLIVQFFQILKGI 576

  Fly   218 TGIEIWIVEKAIYR-RYRNADCDDEFLYPYDLGWRANLRLVFNDECQKRGDGIEWP--VVEGCDQ 279
            |..|::|:.|..:: ::.|       |.|::       ..::..|.:    |:|..  :.||...
Yeast   577 TTPELFILIKEEHKAKFIN-------LIPFE-------NSIYTSESK----GVEDSDMIPEGPSA 623

  Fly   280 YTLTREQLAQKEEKRARTR 298
            .|:|........|.|.|.|
Yeast   624 TTITHTISIDGLEPRNRRR 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 34/151 (23%)
AKR2NP_014677.1 ANKYR 1..195 CDD:223738
ANK repeat 54..81 CDD:293786
ANK repeat 83..115 CDD:293786
ANK repeat 117..148 CDD:293786
ANK repeat 189..220 CDD:293786
Ank_4 190..243 CDD:372654
ANK repeat 222..247 CDD:293786
COG5273 340..711 CDD:227598 59/279 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.