DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and PFA4

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_014640.1 Gene:PFA4 / 854159 SGDID:S000005363 Length:378 Species:Saccharomyces cerevisiae


Alignment Length:265 Identity:79/265 - (29%)
Similarity:116/265 - (43%) Gaps:65/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SFAGF-AHQAL---FLLLSTLATF---------NYVMATLTGPGLMPKQWHPKDPKDAQFLQYCK 94
            ||.|: ||..:   ||.:....||         :|.:|..|.||.....:.|  |.|. :..:||
Yeast    20 SFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICTNPGRPLPNYKP--PPDI-WRNFCK 81

  Fly    95 KCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFW 159
            ||:.||..|||||:.|::||..|||||||..:|||:||:.:|..||.:.|:    .|.||.|...
Yeast    82 KCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIV----TTSVLFCIQA 142

  Fly   160 RGIYRYYYLTHGLAHLASVQFTLLSIIMCILGMGLAIGVVIGLSML----LFIQLKTIVNNQTGI 220
            :.||..:.    ..||....|....:|...:...|...|::.:::|    ||.|   |:|.::.|
Yeast   143 KRIYFIWQ----QRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQ---ILNGRSQI 200

  Fly   221 EIWIVEK-------------------AIY---RRYRNADCDDEFL------------YPYDLGWR 251
            |.|.:::                   .||   |.::|....:|.|            :|||....
Yeast   201 ESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKDAEEHLTKKRPRFDELVNFPYDFDLY 265

  Fly   252 ANLRL 256
            .|..|
Yeast   266 TNALL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 50/137 (36%)
PFA4NP_014640.1 COG5273 1..344 CDD:227598 79/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2699
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46724
orthoMCL 1 0.900 - - OOG6_103912
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.