DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and AKR1

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_010550.1 Gene:AKR1 / 851857 SGDID:S000002672 Length:764 Species:Saccharomyces cerevisiae


Alignment Length:393 Identity:77/393 - (19%)
Similarity:144/393 - (36%) Gaps:107/393 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TTLYMNSMWW----PPNKSFAGFAHQALFLLLSTLATFNYVMATLT--GPGLMPKQWHPKDPKD- 86
            |.|::..:|:    |  ::|:...:..:.:|:..::.| |:...|.  .||.:|::...::.:. 
Yeast   395 TLLWVTIVWFFKVMP--RTFSDEQYTNILMLVILVSVF-YLFGQLVIMDPGCLPEETDHENVRQT 456

  Fly    87 -AQFLQ--------YCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFL-- 140
             :..|:        :|.:....|..||......:..|.:.||:||||.:.||..||..|.:|:  
Yeast   457 ISNLLEIGKFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITL 521

  Fly   141 ----LFSILGSLQGTVVLCCSFWRGIYRYYYLTH---------GLAHLAS----VQFTLLSIIMC 188
                :|:.|       .||..::..:...:..|.         |.:.|.|    .:|..|.::..
Yeast   522 MESGIFTFL-------ALCLEYFDELEDAHEDTSQKNGKCFILGASDLCSGLIYDRFVFLILLWA 579

  Fly   189 ILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRNADCDDEFLYPYDLGWRAN 253
            :|..       |.::.|:|:|...|....|..|..::.|           :.:.:.|..|.:..|
Yeast   580 LLQS-------IWVASLIFVQAFQICKGMTNTEFNVLMK-----------ESKSIGPDGLSFNEN 626

  Fly   254 LRLVFN----------DECQKRGDGIEWPV-----------------VEGCDQY-TLTREQLAQK 290
                ||          |..::..|.:..||                 |.|.||: .:.:|.:..|
Yeast   627 ----FNTTPEGFAPSIDPGEESNDTVLAPVPGSTIRKPRTCFGVCYAVTGMDQWLAVIKETIGIK 687

  Fly   291 EE---------KRARTRTFKCTRPVTGRWL--PIFSQGWRVCVAAPCSDEPRISLRPNDMIKVTR 344
            :.         .|..| .:...|.|...||  .|.:..||..:..|...:..::....|..|:.:
Yeast   688 DSTGHNVYSITSRIPT-NYGWKRNVKDFWLTSDINAPLWRRILYPPSGSKALLNGIEVDYFKLYK 751

  Fly   345 FRN 347
            ..|
Yeast   752 LPN 754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 36/160 (23%)
AKR1NP_010550.1 ANK repeat 75..101 CDD:293786
ANKYR 78..270 CDD:223738
ANK repeat 103..140 CDD:293786
ANK repeat 142..173 CDD:293786
ANK repeat 213..244 CDD:293786
ANK repeat 246..271 CDD:293786
COG5273 363..725 CDD:227598 71/362 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.