DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and AT5G04270

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_196047.3 Gene:AT5G04270 / 830306 AraportID:AT5G04270 Length:271 Species:Arabidopsis thaliana


Alignment Length:292 Identity:86/292 - (29%)
Similarity:134/292 - (45%) Gaps:50/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RRFLHWGPITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQALFLLLSTLATFNYVMATLTGPG 73
            |||.....:..:.::..:...||::....|...:|.||..:..||.||::|..|:..:..|..||
plant     4 RRFFSIPVLLVILVMGFVYYVTLFVFIDDWVGLQSSAGKLNALLFSLLASLCLFSLSICVLVDPG 68

  Fly    74 LMPKQWHPKDPKDAQF-------LQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWA 131
            .:|..:.| |.:|:.:       .:.|.||..||..|:||||.|.|||.||||||.|||:|||:|
plant    69 RVPASYAP-DVEDSGWSNSNVTETRKCDKCFAYKPLRTHHCRVCRRCVLKMDHHCLWINNCVGYA 132

  Fly   132 NHAYFTYFLLFSILGSLQGTVVL-CCSFWRGIYRYYYLTHGLAHLASVQFTLLSIIMCILGMGLA 195
            |:..|...:.::.:.|:..||:| ||:|          .:|.::..:|..... |:.|.:.|   
plant   133 NYKAFFILVFYATVASIYSTVLLVCCAF----------KNGDSYAGNVPLKTF-IVSCGIFM--- 183

  Fly   196 IGVVIGLSMLLFIQLKTIVNNQTGIE-------IWIVEKAIYRRYRNADCDDEFLYPYDLGWRAN 253
            ||:.|.|..||...:..|.:|.|.||       .|:..|:          ...:.:.:|:|:..|
plant   184 IGLSITLGTLLCWHIYLITHNMTTIEHYDSKRASWLARKS----------GQSYRHQFDVGFYKN 238

  Fly   254 LRLVFNDECQKRGDGIEWPVVEGCDQYTLTRE 285
            |..|.....      |:|.    |..:|...|
plant   239 LTSVLGPNM------IKWL----CPTFTRNPE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 52/148 (35%)
AT5G04270NP_196047.3 DHHC 90..211 CDD:396215 52/134 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2851
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3745
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.