DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and AT3G60800

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_191639.2 Gene:AT3G60800 / 825251 AraportID:AT3G60800 Length:307 Species:Arabidopsis thaliana


Alignment Length:273 Identity:73/273 - (26%)
Similarity:112/273 - (41%) Gaps:73/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SFAGFAHQALFLLLSTLATFNYVMATLTGPGLMPKQWHP--------KDPKDA-QF--------- 89
            |.|......||..|..:..::|.....|.||::|..|.|        .||.:: .|         
plant    57 SLAALTILILFHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLNSLDFVGLQSDSSS 121

  Fly    90 ----LQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQG 150
                :::|:||...|..|.|||..|.|||.||||||.|:.:|||..|:.||..||.::.|.:...
plant   122 SNPRVRFCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLV 186

  Fly   151 TVVLCCSFWRGIYRYYYLTHGLAHLASVQF-----TLLSIIMC-ILGMGLAIGVVIGLSMLLFIQ 209
            |:||             :.|.:|..:..:.     ||.:..:. :|.:..|:.|:    ..|.:.
plant   187 TLVL-------------MPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVM----GFLIMH 234

  Fly   210 LKTIVNNQTGIEIWIVEKAIYRRYRNADCDDEFLYPYDLGWRANLRLVF------------NDEC 262
            :..:..|.|.||.:  ||....::|           ||||.:.|...||            .:|.
plant   235 ISLVAGNTTTIEAY--EKKTTTKWR-----------YDLGKKKNFEQVFGMDKRYWLIPGYTEED 286

  Fly   263 QKRG---DGIEWP 272
            .:|.   .|:|:|
plant   287 LRRMPELQGLEYP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 44/152 (29%)
AT3G60800NP_191639.2 DHHC 63..283 CDD:418707 66/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.