DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and AT3G56930

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_191252.1 Gene:AT3G56930 / 824860 AraportID:AT3G56930 Length:477 Species:Arabidopsis thaliana


Alignment Length:244 Identity:57/244 - (23%)
Similarity:98/244 - (40%) Gaps:69/244 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LLSTLATFNYVMATLTGPGLMPKQWHPKDPKDAQ------------------------------- 88
            :|:.|..|..:|.:...||::|:.:.|.:..||.                               
plant    78 ILTILDIFFLLMTSSRDPGIVPRSFRPPETDDAPDSTTPSMEWVSGRTPNIRIPRVKDVTVNGHT 142

  Fly    89 -FLQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTV 152
             .:::|..|..|:.||:.||..|:.||::.||||||:..|:|..|:.:|..|:         .|.
plant   143 VKVKFCDTCLLYRPPRASHCSICNNCVQRFDHHCPWVGQCIGVRNYRFFFMFI---------STS 198

  Fly   153 VLCCSF-----WRGIYRYYYLTHGLAHLASVQFTLLS---IIMCILGMGLAIGVVIGLSMLLFIQ 209
            ...|.:     |..|:: .::...::...::...:||   |:.|.:.:....|:.|..|.|    
plant   199 TTLCIYVFAFSWLNIFQ-RHMDEKISIWKAISKDVLSDILIVYCFITVWFVGGLTIFHSYL---- 258

  Fly   210 LKTIVNNQTGIEIWIVEKAIYRRYRNADCDDEFLYPYDLGWRANLRLVF 258
               |..|||..|.:        |||.    |:...||:.|...|:..:|
plant   259 ---ICTNQTTYENF--------RYRY----DKKENPYNKGILGNIWEIF 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 38/141 (27%)
AT3G56930NP_191252.1 DHHC 146..271 CDD:396215 38/149 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.