DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and AT3G04970

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_187148.2 Gene:AT3G04970 / 819657 AraportID:AT3G04970 Length:397 Species:Arabidopsis thaliana


Alignment Length:149 Identity:46/149 - (30%)
Similarity:67/149 - (44%) Gaps:27/149 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LTTLY---MNSMWWPPNKS--------FAGFAHQALFLLLSTLATFNYVMATLTGPGLMPKQ--- 78
            |..:|   |.|.::...||        :.|..|:....|...:....:::...:.||.:..:   
plant    80 LQVIYIAIMGSTYFLTAKSSFIYIPGYYLGDVHKYTSFLAVIVGVILFLLTCFSDPGTVNAENVS 144

  Fly    79 ----WHPKDPKDAQFLQYCKK-CEGYKAP---RSHHCRKCDRCVKKMDHHCPWINHCVGWANHAY 135
                .:|.|.     :.|.|| |...|.|   ||.||..|:|||.:.||||.|:|:|:|..|..|
plant   145 RYISAYPYDD-----IIYSKKECSTCKIPKPARSKHCSICNRCVARFDHHCGWMNNCIGERNTKY 204

  Fly   136 FTYFLLFSILGSLQGTVVL 154
            |..|||:..|..|.|||.:
plant   205 FMAFLLWHFLLCLYGTVAI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 33/70 (47%)
AT3G04970NP_187148.2 DHHC 90..>218 CDD:388695 39/132 (30%)
DHHC 155..305 CDD:366691 33/69 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.