DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and ZDHHC14

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_016866796.1 Gene:ZDHHC14 / 79683 HGNCID:20341 Length:506 Species:Homo sapiens


Alignment Length:255 Identity:59/255 - (23%)
Similarity:99/255 - (38%) Gaps:75/255 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RFLHWG-------PITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQALFLLLSTLATFNYVMA 67
            |.|.||       |..:..:..|:..:..|:.....|...:.||.   ..|.::.||     :..
Human    74 RALPWGQRGWSCLPTISSWLAGCLLRSCPYLAVKITPAIPAVAGI---LFFFVMGTL-----LRT 130

  Fly    68 TLTGPGLMPKQWHPKDPKDAQ------------------------------FLQYCKKCEGYKAP 102
            :.:.||::|:. .|.:..|.:                              .|:||..|:.::.|
Human   131 SFSDPGVLPRA-TPDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQTVKLKYCFTCKIFRPP 194

  Fly   103 RSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYY 167
            |:.||..||.||::.||||||:.:|||..|:.:|..|:|     ||....|...:|        .
Human   195 RASHCSLCDNCVERFDHHCPWVGNCVGKRNYRFFYMFIL-----SLSFLTVFIFAF--------V 246

  Fly   168 LTHGLAHLASVQF---------TLLSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQT 218
            :||.:.......|         ::|..::|.    .::..::|||   ......|.:|||
Human   247 ITHVILRSQQTGFLNALKDSPASVLEAVVCF----FSVWSIVGLS---GFHTYLISSNQT 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 41/139 (29%)
ZDHHC14XP_016866796.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.