DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc24

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_081752.2 Gene:Zdhhc24 / 70605 MGIID:1917855 Length:284 Species:Mus musculus


Alignment Length:253 Identity:70/253 - (27%)
Similarity:91/253 - (35%) Gaps:81/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AHQALFLL------LSTLATFNYVMATLTGPGLMPKQWHPKDPKDAQFLQYCKKCEGYKAPRSHH 106
            |:|.|.||      |.:..:...||  |.|.||            .|...||.:|:....|||.|
Mouse    59 AYQLLNLLGNVVLFLRSDPSIRGVM--LAGRGL------------GQGWAYCYQCQSQVPPRSGH 109

  Fly   107 CRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFS---------ILGS-----LQG-----TV 152
            |..|..|:.:.||||..:..|||:.|:..|...||.|         :||.     ||.     ||
Mouse   110 CSACRVCILRRDHHCRLLGCCVGFHNYRPFLCLLLHSAGVLLHISVLLGPALSALLQAHSALYTV 174

  Fly   153 VLCCSFWRGIYRYYYLTHGLAHLASVQFTLLSII-MCILGMGLAIGVVIGLSMLLFIQLKTIVNN 216
            .|....|      ..|..|...||  ||.|..:: .|:.|     .::.|..:|....|  ::..
Mouse   175 ALLLLPW------LMLLTGKVSLA--QFALAFVVDTCVAG-----ALLCGAGLLFHGML--LLRG 224

  Fly   217 QTGIEIWIVEKAIYRRYRNADCDDEFLYPYDLGWRANLRLVFNDECQKRGDGIEWPVV 274
            ||..| |.         |...|       ||||...||:...         |..|.:|
Mouse   225 QTTWE-WA---------RGHHC-------YDLGTCHNLQAAL---------GPRWALV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 45/153 (29%)
Zdhhc24NP_081752.2 zf-DHHC 95..232 CDD:279823 46/161 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.