DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and CG18810

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster


Alignment Length:271 Identity:74/271 - (27%)
Similarity:101/271 - (37%) Gaps:74/271 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SMWWPPNKSFAGFAHQ---ALFLLLSTLATFNYVMATLTGPGLMPK-------------QWHPKD 83
            |.:|.|     |:..|   .|||..:.::  ||||..|..|.:.||             .||.  
  Fly    43 SDYWSP-----GYVFQLLLGLFLFSNVMS--NYVMCILVDPSIDPKLMKNQLVRGQHSEDWHE-- 98

  Fly    84 PKDAQFLQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILG-- 146
                     |.||.....|||.|||||..||...||||.:...|:|..|:.||.|||::..|.  
  Fly    99 ---------CDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCM 154

  Fly   147 -SLQGTVVLCCSFWRGIYRYYYLTHGLAHLASVQFTLLSIIMCILGMGLAIGVVIGLSMLLFIQL 210
             ||..:.:.......|.|:.:.|||...:.|.....::.||                    :.:|
  Fly   155 ISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRII--------------------YFKL 199

  Fly   211 KTI---VNNQTGIEIWI-VEKAIYRRY----RNADCDDEFL--YPYDLGWRANLRLVFNDECQKR 265
            ..|   |.....:.:|| |..|.|..|    |...|.|..|  .|:|...|.|.:...       
  Fly   200 PDIYELVFTLVFVLLWIGVCVATYVAYDQWSRGYFCYDFELQNIPFDRKLRRNFKTFL------- 257

  Fly   266 GDGIEWPVVEG 276
            |..::|..:.|
  Fly   258 GRRMKWTWISG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 39/139 (28%)
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467524
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.