Sequence 1: | NP_650191.1 | Gene: | CG5196 / 41522 | FlyBaseID: | FBgn0038039 | Length: | 427 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038652.1 | Gene: | zdhhc14 / 569667 | ZFINID: | ZDB-GENE-040724-21 | Length: | 513 | Species: | Danio rerio |
Alignment Length: | 221 | Identity: | 52/221 - (23%) |
---|---|---|---|
Similarity: | 85/221 - (38%) | Gaps: | 85/221 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 FNYVM-----ATLTGPGLMPKQWHPKDPKDAQ------------------------------FLQ 91
Fly 92 YCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCC 156
Fly 157 SFWRGIYRYYYLTH--------------------------GLAHLA---SVQFTLLSIIMCILGM 192
Fly 193 GLAIGVVIGLSMLLFIQLKTIVNNQT 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5196 | NP_650191.1 | zf-DHHC | 89..223 | CDD:279823 | 43/159 (27%) |
zdhhc14 | NP_001038652.1 | zf-DHHC | 163..306 | CDD:279823 | 43/158 (27%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 348..369 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |