DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and zdhhc14

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001038652.1 Gene:zdhhc14 / 569667 ZFINID:ZDB-GENE-040724-21 Length:513 Species:Danio rerio


Alignment Length:221 Identity:52/221 - (23%)
Similarity:85/221 - (38%) Gaps:85/221 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FNYVM-----ATLTGPGLMPKQWHPKDPKDAQ------------------------------FLQ 91
            |.:||     |:.:.||::|:. .|::..|.:                              .|:
Zfish   101 FVFVMGMLLRASFSDPGVLPRA-TPEEAADIERQIDANNGPSGPGYRPPPRTREVLINGQTVKLK 164

  Fly    92 YCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCC 156
            ||..|:.::.||:.||..||.||.:.||||||:.:|||..|:.:|..|:|     ||....:...
Zfish   165 YCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGRRNYRFFYLFIL-----SLSFLTIFIF 224

  Fly   157 SFWRGIYRYYYLTH--------------------------GLAHLA---SVQFTLLSIIMCILGM 192
            :|        .:||                          |||.|.   :....:|.:::|.   
Zfish   225 AF--------VITHVILNALRKALALSTAADFEAVQKDPTGLAFLVLSKTALLDVLEVVVCF--- 278

  Fly   193 GLAIGVVIGLSMLLFIQLKTIVNNQT 218
             .::..::|||   ......|.:|||
Zfish   279 -FSVWSIVGLS---GFHTYLISSNQT 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 43/159 (27%)
zdhhc14NP_001038652.1 zf-DHHC 163..306 CDD:279823 43/158 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.