DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and ZDHHC7

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001139020.1 Gene:ZDHHC7 / 55625 HGNCID:18459 Length:345 Species:Homo sapiens


Alignment Length:270 Identity:69/270 - (25%)
Similarity:107/270 - (39%) Gaps:80/270 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PNKSF-AGFAHQALFLLLSTLATFNYVMATLTGP------------------------------- 72
            |:|.| ....:..:|..|:.||..:::...||.|                               
Human    72 PSKDFWYSVVNGVIFNCLAVLALSSHLRTMLTDPEKSSDCRPSACTVKTGLDPTLVGICGEGTES 136

  Fly    73 ------GLMPKQWHPKD------PKDAQFLQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWIN 125
                  |.:||....|:      .|..:.:..|.||...|..|:|||..|.||::||||||||:|
Human   137 VQSLLLGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVN 201

  Fly   126 HCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHLASV--QFT------- 181
            :|||..|..:|..|.::..|.|:. .::||               |...::.|  |:|       
Human   202 NCVGEKNQRFFVLFTMYIALSSVH-ALILC---------------GFQFISCVRGQWTECSDFSP 250

  Fly   182 ----LLSIIMCILGMGLAIGVVIGLSMLLF-IQLKTIVNNQTGIEIWIVEKAIY-RRYRNADCDD 240
                :|.|.:|:.|:     :....:.::| .|:.:|.|::|.||....||..: ||.|......
Human   251 PITVILLIFLCLEGL-----LFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKS 310

  Fly   241 EFLYPYDLGW 250
            .|..|..|.|
Human   311 VFGGPPSLLW 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 45/147 (31%)
ZDHHC7NP_001139020.1 zf-DHHC 168..295 CDD:307600 45/147 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.