DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and ZDHHC13

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_061901.2 Gene:ZDHHC13 / 54503 HGNCID:18413 Length:622 Species:Homo sapiens


Alignment Length:303 Identity:71/303 - (23%)
Similarity:110/303 - (36%) Gaps:75/303 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TTLYMNSMWWP---------PNKSFAGFAHQALFLLLSTLATFNYVMATLTGPGLMPKQWHPK-- 82
            |...::|::|.         |:.:.|.|....:|.:::.|..|....|  |.||........|  
Human   349 TAFLLSSVFWIFMTWFILFFPDLAGAPFYFSFIFSIVAFLYFFYKTWA--TDPGFTKASEEEKKV 411

  Fly    83 ------DPKDAQFLQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLL 141
                  :.....|..:|..|...|..||.||..|:.||.:.|.||.|...|:|:.||.|:.:||.
Human   412 NIITLAETGSLDFRTFCTSCLIRKPLRSLHCHVCNCCVARYDQHCLWTGRCIGFGNHHYYIFFLF 476

  Fly   142 FSILGSLQGTVVL---------CCSFWR--GIYRY------------YYLTHGLAHLASVQFTLL 183
            |  |..:.|.::.         |.:.::  |::.|            |.|.....|.:...|.||
Human   477 F--LSMVCGWIIYGSFIYLSSHCATTFKEDGLWTYLNQIVACSPWVLYILMLATFHFSWSTFLLL 539

  Fly   184 SIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRNADCDDEFLYPYDL 248
            :.:..|..:||.....|.|........:|:...:|                          ||:|
Human   540 NQLFQIAFLGLTSHERISLQKQSKHMKQTLSLRKT--------------------------PYNL 578

  Fly   249 GWRANLRLVFNDECQKRGDGIEWP-VVEGCDQYTLTREQLAQK 290
            |:..||...|...|    .|:..| ||:...|||:......:|
Human   579 GFMQNLADFFQCGC----FGLVKPCVVDWTSQYTMVFHPAREK 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 41/156 (26%)
ZDHHC13NP_061901.2 ANK 1. /evidence=ECO:0000250|UniProtKB:Q8IUH5 43..78
ANK 79..192 CDD:238125
ANK repeat 81..112 CDD:293786
ANK 2. /evidence=ECO:0000255 81..110
ANK repeat 114..146 CDD:293786
ANK 3. /evidence=ECO:0000255 115..144
ANKYR <145..271 CDD:223738
ANK repeat 148..179 CDD:293786
ANK 4. /evidence=ECO:0000255 148..177
ANK repeat 181..247 CDD:293786
ANK 5. /evidence=ECO:0000255 181..211
ANK 6. /evidence=ECO:0000255 216..245
ANK 7. /evidence=ECO:0000255 249..277
zf-DHHC 423..559 CDD:307600 38/137 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.